CAZyme Information: MGYG000000265_03397

Basic Information

• Species: Bacteroides nordii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides nordii
• CAZyme ID: MGYG000000265_03397
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
644	MGYG000000265_19|CGC1	73487.88	5.1266

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000265	5489209	Isolate	China	Asia

• Gene Location: Start: 33388; End: 35322 Strand: -

Full Sequence      

MRKYIIRFCVLIGVSILFSNCSEQKKESHPLLVHKYDNILDISYTPNDSFYCSGWFSDQG
AWMGFTVPQKERWINGFCGPFDLETRRWISQSLVTVGFAEAPDEVFSPDSVVYFPGELYM
RSSSGHGTISQRLFFIDKSNVLLECVSDSNKPLCFYGQALDDNSSYSVVNNSCMLSSSSG
DQYLITFPENVKIHFSGNRYEANVSSASPIYVVISSLENIKGQMFDFGAIAKMQSNPSGF
INKHYQCWNGYLEKVLRSDMPEEYDRIAVKAVVTLIANWRSSRAGLLHDGVVPSHAVGYF
MGFWAWDSWKHAAALADFAPELAKNQVRAMFDYQMDNGMIIDCIYTDIRENNARDSKPPL
AAWAVNKIFEATADTAFVEEMYPQLLHYYHWWYLDRDHDSNGICEFGSVDGTIEAAAWES
GMDNAIRFDCAKMVKNSDTAWSFDQESVDLNAFLAYEYSLLKKLAVVAKQPFNEKEYADI
ISTYFYDKESGFFFDKKLDGTFVKEPGSEAYIPFWAGIATKEQMKEAMKLFTDSTKFSTY
IPFPTVAADNPKFMPRGYWRGPIWLDQTYFAISGLRRYGYVEEADAYTRQVFDRLHGLKG
DGAIHENYETYTGKQLKAPHFSWSAAHLLMLYEEYNRRASVAGL

Enzyme Prediction     

No EC number prediction in MGYG000000265_03397.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	169	635	1.4e-104	0.6140350877192983

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	2.70e-126	10	638	8	786	alpha-glucosidase; Provisional
COG3408	GDB1	2.30e-18	289	632	270	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	3.00e-11	356	636	178	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam03200	Glyco_hydro_63	1.42e-05	375	633	185	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
COG1626	TreA	5.77e-05	416	585	324	493	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89313.1	2.30e-261	2	637	3	642
ALJ59646.1	2.65e-260	2	637	3	642
QUT86878.1	2.84e-260	34	637	35	644
QJR62245.1	2.84e-260	34	637	35	644
QJR61716.1	2.84e-260	34	637	35	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	2.24e-78	56	638	32	759	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	1.16e-77	56	638	32	759	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	1.61e-77	56	638	32	759	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	1.61e-74	56	638	33	760	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
6XUX_A	3.70e-39	56	440	358	803	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	9.63e-78	28	638	20	782	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	1.37e-18	296	629	90	482	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	3.22e-18	296	629	90	482	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
K5BDL0	2.14e-11	290	629	26	442	Glucosylglycerate hydrolase OS=Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849) OX=1122247 GN=ggh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000004	1.000049	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000265_03397.