CAZyme Information: MGYG000000265_03487

Basic Information

• Species: Bacteroides nordii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides nordii
• CAZyme ID: MGYG000000265_03487
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467	MGYG000000265_21|CGC1	54148.4	8.6451

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000265	5489209	Isolate	China	Asia

• Gene Location: Start: 30354; End: 31757 Strand: +

Full Sequence      

MKICKKRKAVIVMLFCSSMLCGQNYVPIHVEAQRWVKEKSNMPWETFETRIIDNLIGFSL
EKRVPTNKYGSDITKKYKATGFFRVEKQGDRWWTIDPEGYHNVPIGINSVNCGRSEGTQK
AFEQIYKSTERWMKVTADSLLDNGFNGTGSWSDIEAIIEYNRSAKQPLTYTPNLNFMMSY
GRKRGGTYQLPGNTGYPNQCIFVFDPEFETFCMEYAQHISKYASDKNLFGFFSDNELPIN
MNNLEGYLKLENKEDPGYMAARRWMDERGLTIDKLSNEDKCEFAGYVAEKYYSIVSKALK
TYAPNHMFLGSRLHGRVTRIEQVLRAAGKYCDIISINYYGKWTPENDAMTNWERYSKRPF
MITEFYTKAMDSGLTNETGAGFTVHTQRDRGYAYQNFCLGLLESKSCVGWHFFKYQDNDP
TAQNVDPSNLNSNKGIVSNRYVYYSSFLIWMKQLNRNVYSLISYLGQ

Enzyme Prediction     

No EC number prediction in MGYG000000265_03487.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	119	459	1.3e-75	0.552833078101072

CDD Domains     

MGYG000000265_03487 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADQ16129.1	2.42e-185	28	467	20	457
QRN02213.1	3.14e-185	6	467	2	464
CBK66218.1	3.25e-185	6	467	3	465
QUT80053.1	1.27e-184	6	467	2	464
QDM12614.1	1.27e-184	6	467	2	464

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T3B_A	5.52e-96	23	464	38	478	ChainA, Glycoside Hydrolase [Phocaeicola plebeius],5T3B_B Chain B, Glycoside Hydrolase [Phocaeicola plebeius]
4BQ2_A	2.43e-22	62	460	239	744	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	5.78e-22	62	460	239	744	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
6XJ9_A	7.83e-22	60	459	256	759	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]
5Z6P_A	1.30e-16	268	459	575	759	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	8.67e-19	76	461	484	951	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	9.98e-14	126	459	551	913	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.014331	0.585500	0.397804	0.001258	0.000666	0.000421

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000265_03487.