CAZyme Information: MGYG000000265_03794

Basic Information

• Species: Bacteroides nordii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides nordii
• CAZyme ID: MGYG000000265_03794
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
229		25444.94	7.7487

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000265	5489209	Isolate	China	Asia

• Gene Location: Start: 21048; End: 21737 Strand: -

Full Sequence      

MIHPLFCESLIVRGVNIFNRGPNGDGCDPESCKNVLIENCTFDTGDDCIAIKSGRNADGR
KWNIPSENIIVRNCKMKNGHGGVVIGSEISGGYRNLFVENCQMDSPNLDRVIRIKTSTCR
GGIIENVFVRNITVGQCREAVLRINLQYENREQCNRGFTPTVRNVHLKNVTCQKSRLGVL
IIGLDDDQHVYNISVEDSHFNNVAKGGNDIKGAHDVTLKNLYINGELVK

Enzyme Prediction     

No EC number prediction in MGYG000000265_03794.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	2	211	4.5e-50	0.5784615384615385

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	5.73e-46	2	133	264	394	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	8.61e-17	19	171	133	274	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN03010	PLN03010	8.81e-08	7	151	188	323	polygalacturonase
PLN02218	PLN02218	1.71e-07	22	171	240	379	polygalacturonase ADPG
PLN03003	PLN03003	9.41e-07	15	101	179	257	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT76979.1	3.49e-161	1	229	239	467
QRN02094.1	9.66e-154	1	229	240	468
QRQ55855.1	9.99e-154	1	229	241	469
SCV08465.1	9.99e-154	1	229	241	469
ALJ49049.1	9.99e-154	1	229	241	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	2.11e-51	2	198	216	408	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	6.02e-37	2	221	226	446	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
2UVE_A	4.44e-11	23	175	379	532	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27644	1.67e-27	2	148	48	196	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
A7PZL3	7.96e-24	2	187	225	412	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P15922	1.97e-12	8	175	356	525	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
P58598	6.26e-09	23	142	284	396	Polygalacturonase OS=Ralstonia solanacearum (strain GMI1000) OX=267608 GN=pglA PE=3 SV=1
Q9FY19	4.96e-08	7	195	215	396	Polygalacturonase OS=Juniperus ashei OX=13101 GN=JNA2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999923	0.000100	0.000003	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000265_03794.