CAZyme Information: MGYG000000266_00054

Basic Information

• Species: Collinsella sp003437035
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp003437035
• CAZyme ID: MGYG000000266_00054
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473	MGYG000000266_1|CGC1	53740.36	4.7541

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000266	2354443	Isolate	China	Asia

• Gene Location: Start: 68994; End: 70415 Strand: -

Full Sequence      

MPLRSDFLWGGALSANQCEGAWDEGGRGLANADLLSYGRDRLAVIRGDDVPLEPLSDHYY
PAQQAIDFYHHYREDIALFGEMGFKALRLSIAWSRIFPNGDDSEPNEQGLAFYEDVFRTC
LEQGIEPVVTLNHYDVPMHLVTAYGGWRNRALVGMFERFARTVFARYRNQVRSWLTFNEI
NIMTSACFMAAGIVFDEGEDRYVSVHNAVHHVLVASACAVRACHEIIPGAQIGCMLNAGI
FYPATCNPADVKTAQDENRKHYMFTDVQVRGHYPCYMLTEYERQGFAIPWAEGDEEVLAQ
NPVDFVGFSYYSTRVAQANTEGQFDSNLLKSAPNPYLKMEPWGRFIDPAGLRITMNDIYD
RYEKPLFIVENGLGAPDEPDQNGFVDDGYRIDYLREHIQAMKDAVEIDGVDLLGYTCWGP
IDLVSVATGQMRKRYGFIYVDLDDEGHGTRRRSKKRSFEWYRKVIASNGEDLS

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	4	469	8.8e-142	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	472	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	6	473	7	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	1	472	4	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	6	473	7	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	473	4	478	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA34816.1	1.70e-272	1	473	1	473
AZH70518.1	6.92e-272	1	473	1	473
AYW45337.1	5.15e-221	1	473	1	475
AYW48857.1	2.09e-220	1	473	1	475
BAK95033.1	5.97e-220	1	473	1	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.30e-184	7	472	12	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	4.02e-176	1	472	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	4.46e-173	3	472	7	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.27e-172	3	472	7	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	8.95e-168	3	472	7	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	8.89e-191	7	472	8	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	1.16e-182	7	472	12	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46829	2.20e-175	1	472	6	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	2.91e-168	3	472	4	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P26206	2.22e-164	2	473	4	464	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000266_00054.