CAZyme Information: MGYG000000268_02545

Basic Information

• Species: Schaedlerella sp900066545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Schaedlerella; Schaedlerella sp900066545
• CAZyme ID: MGYG000000268_02545
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
764	MGYG000000268_17|CGC3	85290.88	4.6592

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000268	3370693	Isolate	China	Asia

• Gene Location: Start: 42317; End: 44611 Strand: -

Full Sequence      

MEREKIQNLISQMTLEEKAGMCSGADFWNLKGIERLGIPKVMVTDGPHGIRKQAEAADHL
GINESEKAICFPAGCATASSFDRDLIRRQGELLGQECQAMNVSTILGPAMNIKRSPLCGR
NFEYYSEDPYVSTEIAAALIEGVQSKNVGTSAKHFVANNQEKRRMTNSSDADERTLREIY
LASFEGAIKKAKPWTVMSSYNRINGEFVGDNKEYLTDILRKEWGFDGYVVSDWGAVNDRI
SSLAAGLDLEMPPGDYENDRLIVKAVQEGKLDESVVDQACERILNIIFRYTENRDEKAVF
DYEKDHKAAAEIEAECMVLLKNENEILPLTSDKKIAFIGKYAKTPRYQGGGSSHINSWKV
ESALEAAKEIQELANVTFAEGYQDEKDEVVEALQSEAVKAAAEADVAVLFLGLPDNFESE
GYDRKHMNLPNCQNELVRKVLEVQKHVVVVLHNGSAVLMPWKDQVEGILEAYLGGEAVGK
AVAEVLAGIKNPCGRLAETFPLRLEDTPCYLTYGKGFDNAVYQEGVFVGYRYYTSRKMET
AFPFGYGLSYTTFAYSDLQLDKKEMSDKEHVEVSVKVKNTGKRAGKTVVQLYVAAPEAEV
VRPVRELRGFEKIFLEAGEEKTVTFILGERALAYWNTLIHDWYAEEGTYKVMIGENADQM
CVGEEITVHPTKELPKTYSLNTCLGELMRDPKAQTVMAPFMQGMAQNDAAMDMAEANEND
QSGVVNQEMMAAMMEGMPLRQLLSFVPGIKREMLEQMVNALNQL

Enzyme Prediction     

No EC number prediction in MGYG000000268_02545.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	32	252	1.9e-69	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	5.87e-115	6	654	38	751	beta-glucosidase BglX.
COG1472	BglX	1.62e-72	26	356	48	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.34e-65	317	530	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	2.27e-60	7	627	54	742	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	3.57e-41	35	286	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT30267.1	0.0	1	764	1	764
QHQ63232.1	0.0	4	763	4	755
QUI21624.1	5.68e-305	6	762	2	754
QUC66582.1	1.99e-304	6	763	3	754
AHF25022.1	2.01e-302	2	763	6	765

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.25e-279	6	764	5	754	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.77e-187	10	707	9	702	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.35e-135	4	670	2	721	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.07e-134	4	670	2	721	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	4.50e-127	1	674	1	840	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	9.72e-279	6	764	5	754	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	5.23e-179	10	698	9	701	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	1.17e-177	10	654	9	658	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	5.50e-135	5	660	45	737	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q2U8Y5	1.94e-132	1	653	1	816	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000268_02545.