CAZyme Information: MGYG000000268_02850

Basic Information

• Species: Schaedlerella sp900066545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Schaedlerella; Schaedlerella sp900066545
• CAZyme ID: MGYG000000268_02850
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000000268_25|CGC1	42238.58	5.4642

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000268	3370693	Isolate	China	Asia

• Gene Location: Start: 8988; End: 10106 Strand: +

Full Sequence      

MNIKETELRKKLDLVIEKLLNLEGPDNEKELSDGGEAIGFFKRDFGIREWDWPQGVGLYG
LLKIMEYDKNEKYKEFLQDWFVENMEQGLPSRNINTTTPLLTLAELNEYCHDAKFEKLCL
DWADWLMNCIPRTKEGGFQHVTSANGDRQGVRLNENEMWIDTLFMTVLFLNKMGQKYQNE
EWINEGIHQVLMHIKYLYDKKSGLFYHGWTFNGNNNFGGIFWCRGNSWFTLGILDYIDMF
KGTLNPGVKTIIVDTYKAQVKALKKLQAPSGLWHTVLTDASSYEEVSGSAAIACGILKGI
RMGILDDSYLPCAEKAIKGIMKNIDKDGTVLNVSGGTGMGMNAEHYKNILIAPMAYGQSL
TILALAEALLHL

Enzyme Prediction     

No EC number prediction in MGYG000000268_02850.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	48	368	8.5e-101	0.9608433734939759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.50e-96	49	358	33	339	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.60e-89	49	358	26	329	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU19354.1	4.62e-230	7	372	13	378
ASN96412.1	9.33e-230	7	372	13	378
QRP38799.1	9.33e-230	7	372	13	378
QIX93991.1	1.10e-229	8	372	9	373
QQQ99851.1	1.32e-229	8	372	14	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	1.19e-81	3	369	21	377	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	3.35e-75	3	369	22	378	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	6.39e-73	7	367	7	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	6.66e-24	50	330	23	311	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	1.70e-53	41	369	23	336	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000268_02850.