CAZyme Information: MGYG000000269_01477

Basic Information

• Species: Faecalibacillus sp003480255
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Faecalibacillus; Faecalibacillus sp003480255
• CAZyme ID: MGYG000000269_01477
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459	MGYG000000269_17|CGC1	54110.86	5.1887

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000269	2159883	Isolate	China	Asia

• Gene Location: Start: 27699; End: 29078 Strand: -

Full Sequence      

MNNIDRLLQAIKQPTTDDPYRLHYHLMPPIGWLNDPNGLCQHDGTYHIYYQWAPADVNNG
LKGWGHYATKNFIHYQDLKMPLLPDHPRDQGGAYSGSAIIKDNKIHYFYTGNVKKPGDYD
YILKGREHNFMHVESCDGHILTNKECLMTNEDYPDDLTLHVRDPKIYHRDHDYLVMGARD
KQDVGQVLVYQSDDLKKFDYCCRLKTEKPFGYMWECPDLFELNGQMILLCSPQGIKQDGY
LYENIYQNGYFKVNYDFVNDSIVKDFEEIDNGFDIYAAQTFLDEQGRRILIGWMGLPDVD
YTNPTVQNNWQHALTMPRILDYHDGHLYQKPLPEFKQLRMSQESYKKPHLQLKNNVFELQ
IKNISDTLYLKLRNDFIIEYHNGLMTLTMNESGYGRDIRHLELEHLDSLIIYSDTSSIEM
FINDGYRTFTTRIYSENTDIECSNEINIYYLDSFKIESE

Enzyme Prediction     

No EC number prediction in MGYG000000269_01477.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	25	331	5.3e-82	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	8.18e-140	31	324	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	1.57e-135	18	434	11	443	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	4.67e-121	8	439	16	463	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	3.20e-98	25	331	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	1.47e-92	25	425	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQV06328.1	8.43e-175	8	456	9	465
QMW75218.1	4.83e-174	8	456	9	465
QPS14445.1	4.83e-174	8	456	9	465
QQY26690.1	6.85e-174	8	456	9	465
QNM14308.1	1.07e-158	9	459	14	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	6.95e-65	2	434	5	458	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
6NU7_A	3.18e-60	7	439	20	467	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7BWB_A	2.32e-59	10	436	38	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	3.38e-58	10	436	38	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
1UYP_A	7.00e-42	20	458	2	429	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	1.24e-94	12	434	19	453	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P13394	1.87e-88	24	437	40	456	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
Q05936	1.50e-86	4	457	21	488	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
A1STJ9	1.80e-75	20	443	95	523	Probable sucrose-6-phosphate hydrolase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=Ping_0974 PE=3 SV=1
P37075	1.04e-74	2	434	5	438	Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium OX=90371 GN=scrB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000269_01477.