CAZyme Information: MGYG000000272_00298

Basic Information

• Species: Prevotella hominis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella hominis
• CAZyme ID: MGYG000000272_00298
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
764	MGYG000000272_2|CGC3	88418.8	7.8068

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000272	3991064	Isolate	China	Asia

• Gene Location: Start: 137486; End: 139780 Strand: +

Full Sequence      

MYMRKILFYLFLLTVTSIQANPVDDILERIDKGASRKFQTILVKSDKDFFEIDQKSHPSS
NSRKTSSPIIIRGNSWVNIAVGVNWYLKHYAGIHISWNNMTAKIPAVLPRVEKKERHETD
LKLRYDFNYCTFSYSMAFWDWNRWQKEIDWMALHGINMPLAIVGEECVWRNMLLKLGYTE
EEVGKFIAGPAFLAWWEMNNLEGWGGPLPLNWYKQQEVLQKKILARMKELGMKPVLPGYC
GMMPHDAKEKLGLNVTDGGRWNGYQRPANLSPTDARFAEIADLYYKELTHLFGKASYYSM
DPFHESNDDAAVDYGKAGKVLMDAMKRANSEAVWVVQGWTENPRPQMIENLKVGDLLILD
LFSECRPMFGSPSIWKREGGYGKHQWLFCLLENFGGNVGLHGRMDQLLNNFYLATGKKNV
QKQENSSFITNSSMKGWGFTMEGSENNPVMFELMSELPWRAEKMTKEEWIQEYCFARYGV
HDDTIVKAWTLLAKSIYNCPLGNNQQGPHESIFCGRPSLNNFQVSSWSKMHNYYDPEDTR
QAAILFAQVADKYKGNNNYEYDLVDICRQALADQGRKQYLKTIADYNAFARKDFDKNADR
FLKMILLQDKLLGTRSEFRLGHWTEQARKIGKTTAEKDQYEWNARVQITTWGNRTCADKG
GLRDYAHKEWQGLLKDFYYKRWSTYMKALKDQMKASTQVDYEALGGGKNANKTAAELFQM
ALPGGPVIDWYAIEEPWTLQHNTYSDQPEGDCVEVAKEVINFIR

Enzyme Prediction     

No EC number prediction in MGYG000000272_00298.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	68	760	7.8e-249	0.9909502262443439

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	1.43e-178	124	461	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	9.38e-106	469	757	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	2.44e-24	21	109	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ80311.1	0.0	3	763	1	743
ADE81419.1	0.0	3	763	1	743
BCS86259.1	0.0	3	764	98	839
AGB28890.1	0.0	19	763	38	774
QDO68555.1	0.0	3	758	1	711

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VC9_A	1.06e-135	21	758	169	875	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	1.30e-135	21	758	177	883	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	1.44e-134	21	758	192	898	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]
4XWH_A	2.40e-119	71	759	54	707	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FNA3	2.23e-123	12	692	38	758	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
P54802	2.41e-118	71	759	77	730	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000227	0.999187	0.000144	0.000150	0.000137	0.000131

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000272_00298.