CAZyme Information: MGYG000000272_00409

Basic Information

• Species: Prevotella hominis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella hominis
• CAZyme ID: MGYG000000272_00409
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348		39330.33	9.5375

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000272	3991064	Isolate	China	Asia

• Gene Location: Start: 81974; End: 83020 Strand: +

Full Sequence      

MNKQNRLCYISRNYYNLTSAGNKAKTDNEDTLDEMGAVNLGLHRTVRNSKIIAFFLDLAG
ILRACLLLQKGDTLFLQYPVKKYFSFLCKIARMKGAKTVSLIHDLGSFRRKKLTVEKEIS
RLSHSDYIIASNENMKKWLKEHGMQKPVGALGLFDYHSASPCQEKASDRKQPKVVYAGAL
SMKKNSFLVELSKTLTNWQLLVCGNKEGLQGLKENPLITYQGFVPSEDFIKSIDADFGLV
WDGDSLDTCSGEYGQYLKWNSPHKVSFYLRAGLPLIIWKEAAVAPIIEEAGAGIAINSLK
ELDEKLANLTFDDIANLKQNAKRLAERLNHGHFLRQALDIYFSTHQQR

Enzyme Prediction     

No EC number prediction in MGYG000000272_00409.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	18	339	1.6e-92	0.9627329192546584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	8.72e-70	19	338	15	326	sugar transferase.
cd03794	GT4_WbuB-like	1.55e-11	88	338	116	386	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS85168.1	2.02e-132	6	338	4	336
ALJ61055.1	1.64e-98	9	339	5	336
QUT93412.1	1.64e-98	9	339	5	336
AVM53009.1	1.20e-95	13	344	2	332
AVM58068.1	2.42e-95	13	344	2	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QKW_A	2.26e-09	68	338	64	322	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	2.33e-09	68	338	72	330	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37749	2.98e-40	20	339	14	321	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
A0A0H2UR93	5.03e-14	71	338	65	326	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
Q9AEU1	2.44e-12	71	338	65	325	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1
B3XPQ7	1.62e-09	69	338	63	325	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1
F8KEJ1	9.57e-09	69	338	68	330	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999963	0.000041	0.000004	0.000001	0.000000	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000272_00409.