CAZyme Information: MGYG000000272_01382

Basic Information

• Species: Prevotella hominis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella hominis
• CAZyme ID: MGYG000000272_01382
• CAZy Family: GH36
• CAZyme Description: Alpha-galactosidase AgaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
726	MGYG000000272_15|CGC1	83182.73	6.4585

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000272	3991064	Isolate	China	Asia

• Gene Location: Start: 27983; End: 30163 Strand: +

Full Sequence      

MKKVFMIIAAMCMTSVMAFAQKTIRVSTDKTDLVMQVSPKGRLYQVYLGDKLKNPADYQN
LKWDVYAASDGAVCQRGHEVYATSGAEDFFEPAVAVTHADGNMTTYLYYQSSEEKAISGG
VETIITLKDKVYPLTVKLHYAAYPKENVIKAWSEISHKEKAPVTLWRYSSTMLYFKANKY
FVTNYHSDWAKEGQPETCQLTAGKKIVDTKLGTRAAMQEEPFFELGFDEPAKENEGKVML
GTIGWPGNFRFTFEVDNVGALRVIPAINPYASDYKLKAGETFTTPEFIFAMSDNGMGEAS
RNLHNWARQYQVNMGMENRLTLLNNWENTGFDFNQQSLAELMKDAKDLGVDMFLLDDGWF
ANKYPRKDDHAGLGDWEATKSKLPEGIPGLVRDAKKAGVKFGIWIEPEMVNPKSELFEKH
PDWVIMQPKRDTYYYRNQLVLDISNPKVQDYVFGIVDRIMTENPDVAYFKWDCNSVITNI
YSPYHKENQGNFYIDHVRGIYKVLTRIHNKYPKLPMMLCSGGGGRMDYEMLKYFTEFWCS
DDTDPFERIYIQWSLSKFFPAKTMGSHVTNWNKNTSVKFRTDVCSSCKLGFDIDLKSLSD
DDYKFVQNAVKNYDNMKPMILEGDQYRLVSPYEGNHCAINYVSKDKQRAVLFAYDLHPRY
KEPVMNVKMQGLDADKVYTVKETNLMPGKESDLECNGKQYSGDYLMKVGLNVFSQTDGTS
HVLVLE

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	24	711	9.4e-210	0.9956395348837209

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02065	Melibiase	1.01e-113	281	623	1	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	3.04e-105	24	712	4	667	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14791	GH36	3.95e-103	319	613	2	297	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16875	Glyco_hydro_36N	1.22e-65	41	277	1	256	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
pfam16874	Glyco_hydro_36C	1.26e-22	636	725	1	78	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT67482.1	0.0	1	726	1	726
QUB67953.1	0.0	1	725	1	726
QUB65620.1	0.0	2	725	3	726
QUB63069.1	0.0	1	725	1	726
QUB75368.1	0.0	1	725	1	726

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FNR_A	4.73e-107	81	690	76	702	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNQ_A	1.30e-106	22	690	10	702	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNP_A	9.83e-106	81	690	76	702	Crystalstructure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNS_A Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus]
4FNT_A	1.38e-105	81	690	76	702	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus]
4FNU_A	3.78e-105	81	690	76	702	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ALJ4	2.59e-106	81	690	76	702	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
Q92457	6.12e-104	48	726	58	743	Alpha-galactosidase 2 OS=Hypocrea jecorina OX=51453 GN=agl2 PE=1 SV=1
P43467	6.60e-103	81	709	78	710	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
Q0CVH2	1.02e-100	81	726	95	745	Probable alpha-galactosidase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=aglC PE=3 SV=1
P27756	4.01e-100	79	712	71	703	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000305	0.999003	0.000208	0.000170	0.000155	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000272_01382.