CAZyme Information: MGYG000000272_01761

Basic Information

• Species: Prevotella hominis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella hominis
• CAZyme ID: MGYG000000272_01761
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329		36955.22	7.8466

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000272	3991064	Isolate	China	Asia

• Gene Location: Start: 21545; End: 22534 Strand: +

Full Sequence      

MKKVLLAMMLFLAAWPVLAANKYDNPDTLVVSRDGTGEFRTIDEAIEVCRAFMDYTKVIY
VKKGVYKEKLIIPSWLTNITICGEDRDNTIITWDDHANIKMPVGGLDSEAAVKGKPMGTF
RTYTLKVQGSYITLKDITIENNAAKLGQAVALHTEGDHILVQNCRLLGNQDTVYTGVGGT
RVAFYDCYIEGTTDFIFGPSIAWFQNCEIHSKANSYITAASTPAGQKYGYVFYKCRLTAD
KDVDKVYLGRPWRPFAATIFMDCELGKHIRPEGWHNWNNAKNEETARYAEYGNKGEGAST
KNRVKWSKQLSKKEAAKVTLLDAFGEDCW

Enzyme Prediction     

No EC number prediction in MGYG000000272_01761.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	29	320	2.1e-102	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	4.14e-84	30	319	3	290	Pectinesterase.
PLN02773	PLN02773	6.22e-74	29	317	7	289	pectinesterase
COG4677	PemB	1.04e-68	26	324	80	402	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02682	PLN02682	1.56e-65	19	315	61	352	pectinesterase family protein
PLN02432	PLN02432	2.58e-59	29	329	13	291	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT66521.1	1.37e-194	1	329	1	329
BCS84477.1	7.88e-161	1	324	1	315
QVJ81978.1	2.85e-153	1	329	1	320
ADE82952.1	2.85e-153	1	329	1	320
QJR97878.1	3.51e-153	20	324	13	310

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	1.74e-42	29	306	9	281	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	3.27e-42	30	306	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	4.80e-32	29	303	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.53e-31	29	303	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	7.30e-26	32	326	12	336	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	3.43e-54	31	315	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P41510	7.47e-51	28	318	272	558	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q5MFV6	1.11e-49	28	318	276	562	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
Q42608	1.21e-48	28	318	259	545	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
Q8VYZ3	2.88e-47	19	315	75	366	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000264	0.999068	0.000178	0.000161	0.000152	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000272_01761.