CAZyme Information: MGYG000000272_02298

Basic Information

• Species: Prevotella hominis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella hominis
• CAZyme ID: MGYG000000272_02298
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396		45754.35	8.802

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000272	3991064	Isolate	China	Asia

• Gene Location: Start: 5620; End: 6810 Strand: -

Full Sequence      

MMMAAAALALPLSAAQPAKKTAKVKKVNKKEVKATKKWDHEQVVELIKKVNTYWQTNNKA
EVRAFWDNAAYHTGNMEVYKMLKDQKMLDYSIRWAEHNDWTGAREANPAKWKYKPYGEGK
EHVLFGDWQICFQTYIDLYNIEAAKGNAEASEFMVKRAKEVMHYEAYSEPTDYWWWSDAL
YMVMPVMTKMYKLTGDTKYLDKLYDNLLTTDEIMLDKETNLYFRDGKYVYPKHKSANGKK
DFWARGDGWVLAGLAKVLQDMPKDYKHYQFFVDKFQKLAKAVAEIQQPEGYWTRSMMDPE
HAPGPETSGTAFFTYGMLWGVNNGFLAKKEYKKTIERAWTYLTETAVQEDGKVGYVQPIG
ERAIPGQTVDANSQANFGVGAMLLVACEYDKYLATK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	56	390	1.8e-78	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.31e-84	47	393	10	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	9.18e-41	74	389	44	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ79822.1	2.36e-204	36	394	19	370
ADE82673.1	1.11e-202	36	393	19	369
AGB28481.1	4.15e-186	38	393	22	378
BCS84432.1	2.67e-184	42	393	9	363
QQY40390.1	5.21e-175	46	393	35	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	2.72e-169	42	393	32	375	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	5.70e-144	28	393	5	358	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	7.67e-55	66	388	53	365	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	1.04e-13	173	351	138	322	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.25e-13	173	351	128	312	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	5.00e-54	66	388	60	372	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	3.81e-53	168	388	151	371	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	2.40e-45	174	388	199	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	5.69e-13	173	351	138	322	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.901871	0.097767	0.000106	0.000108	0.000071	0.000095

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000272_02298.