CAZyme Information: MGYG000000273_00250

Basic Information

• Species: Phocaeicola coprophilus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola coprophilus
• CAZyme ID: MGYG000000273_00250
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
718	MGYG000000273_2|CGC1	83067.47	6.043

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000273	3492533	Isolate	China	Asia

• Gene Location: Start: 47147; End: 49303 Strand: -

Full Sequence      

MKKILCLISLFLLGVTLYASPITGLLERIDKGASRKFVIERLKGEKDFFELDQKGNKVVV
RGNNYVSIATGINWYLKYYAGINLSWNGMQADLPEVLPPVLKKERHETDLKLRYDFNYCT
FSYSMAFWDWKRWEQEIDWMALHGINLPLAMVGTDVVWKNVLEELGYTREEINAFIAGPG
FQAWWLMNNLEGWGGPNPDSWYERQEELQKRILKRMREYGIEPVLPGYSGMVPHNAKDRL
GLNVADPGRWNGYPRPAFLQPTDPQFERIAALYYREMTRLYGKVSYYSMDPFHEGGNTSG
VDLEAAGKAIWKAMKQANPRAAWVVQAWGANPRPQMIRNLPAGDMVVLDLFSESRPQWGD
PASSWYRKEGFGQHDWLFCMLLNYGGNVGLHGKMAHLIEEFYKAKDSSFGKTLKGVGMTM
EGIENNPVMYELLCELPWREQRFSKDEWLEGYLKARYGKSDSQVSQAWMLLSNTIYNCPA
ASTQQGTHESILCARPSWKAYQVSSWSEMSDYYDPADVIRAAGMMVDAAERFRGNNNFEY
DLVDIVRQAVAEKGRLMYRVLVDAYKAGDRELFKLSSDQFLRLILMQDRLLATRSEFKVG
RWLESARNLGSTEEEKDWYEWNARVQITTWGNRVAADDGGLHDYAHREWNGLLRDFYYLR
WKTWLDEQLKSFEGGQPKAIDFYALEEPWTLKHNSYASEAEGNPVDIACEIYREIKLP

Enzyme Prediction     

No EC number prediction in MGYG000000273_00250.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	55	712	5.6e-258	0.9939668174962293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	0.0	113	440	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	2.30e-113	448	708	1	257	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	4.27e-32	20	98	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24616.1	0.0	1	718	1	718
QUT50280.1	0.0	3	715	2	715
ADV42401.1	0.0	2	715	3	715
QRP91352.1	0.0	2	716	3	718
QCQ40346.1	0.0	2	716	3	718

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VC9_A	5.23e-160	36	712	189	877	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	6.50e-160	36	712	197	885	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	7.62e-159	36	712	212	900	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]
4XWH_A	4.98e-128	57	712	51	708	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	5.10e-127	57	712	74	731	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	5.27e-126	32	705	75	787	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000351	0.998950	0.000185	0.000157	0.000166	0.000154

TMHMM  Annotations     

start	end
7	26