CAZyme Information: MGYG000000273_00755

Basic Information

• Species: Phocaeicola coprophilus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola coprophilus
• CAZyme ID: MGYG000000273_00755
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459		51355.6	7.9366

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000273	3492533	Isolate	China	Asia

• Gene Location: Start: 99222; End: 100601 Strand: -

Full Sequence      

MKWGRLCCLCLLIGCLLACHSGSNHSEETGEENDLPQIIDRGELVVLTVNGSTSYFNYRG
EPMGFQYELAQQFAASLGVKLKLKVVKNTEELVRQLLNGEGDLIAYNLPVTNALKDSVIY
CGEANITHQVVVQRKGKDALKNVTQLVGKEVYVQPGKYQERLINLDKELGGGIQIHTIAA
DSISAEELISWVAEGKIDYTVSTDELAKINRTYYPNLNIGLAISFDQRASWAVRKSSPLL
AQAADKWHKENINSPEFKASAKRYFELNKHVPHGTILSLKDGRISHFDQLFRTYAKEIGW
DWRLLASLAYVESNFDPKAVSWAGAKGLMQLMPATARSFGVPAGKEQDPEESVKAAVKYI
AALQQSFGKVKDKDEQVKFVLAAYNAGVGHVTDAMALSEKYGRSSTVWEHHVAHYMLLKS
NEEFYQDPVCKNGYFRGTETYNFVKRVIALADDYRKKIK

Enzyme Prediction     

No EC number prediction in MGYG000000273_00755.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	299	456	1.4e-27	0.837037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10859	PRK10859	2.41e-94	28	447	29	443	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	6.72e-81	28	447	9	424	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
cd13403	MLTF-like	5.19e-75	291	456	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd01009	PBP2_YfhD_N	1.90e-70	42	266	1	223	The solute binding domain of YfhD proteins, a member of the type 2 periplasmic binding fold protein superfamily. This subfamily includes the solute binding domain YfhD_N. These domains are found in the YfhD proteins that are predicted to function as lytic transglycosylases that cleave the glycosidic bond between N-acetylmuramic acid and N-acetylglucosamin in peptidoglycan, while the YfhD_N domain might act as an auxiliary or regulatory subunit. In addition to periplasmic solute binding domain, they have an SLT domain, typically found in soluble lytic transglycosylases, and a C-terminal low complexity domain. The YfhD proteins might have been recruited to create localized cell wall openings required for transport of large substrates such as DNA. They belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.
cd00254	LT-like	8.82e-27	303	396	2	90	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO25393.1	0.0	1	459	1	459
ADY35947.1	2.66e-248	10	459	8	458
QEW37633.1	3.53e-225	15	459	13	458
QJR58978.1	5.01e-225	15	459	13	458
AND20002.1	5.01e-225	15	459	13	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OYV_A	5.42e-43	26	447	2	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OWD_A	5.34e-42	26	447	2	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
4OZ9_A	1.25e-41	35	447	4	414	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
5AA1_A	2.09e-40	35	447	45	455	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_B Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA3_A	2.09e-40	35	447	45	455	Crystalstructure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_B Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_C Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_D Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_E Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_F Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_G Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_H Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_I Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_J Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_K Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_L Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8ZWR8	1.37e-61	37	457	36	451	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
A0KJ50	2.46e-53	33	447	38	446	Membrane-bound lytic murein transglycosylase F OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=mltF PE=3 SV=1
A4SNZ5	6.78e-52	33	447	38	446	Membrane-bound lytic murein transglycosylase F OS=Aeromonas salmonicida (strain A449) OX=382245 GN=mltF PE=3 SV=1
Q47XX8	5.44e-51	27	447	21	435	Membrane-bound lytic murein transglycosylase F OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) OX=167879 GN=mltF PE=3 SV=2
Q2NS21	7.43e-50	32	447	33	443	Membrane-bound lytic murein transglycosylase F OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000006	1.000024	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000273_00755.