CAZyme Information: MGYG000000273_01414

Basic Information

• Species: Phocaeicola coprophilus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola coprophilus
• CAZyme ID: MGYG000000273_01414
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
881		99536.83	5.5413

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000273	3492533	Isolate	China	Asia

• Gene Location: Start: 90282; End: 92927 Strand: -

Full Sequence      

MKKQIILSACLFAAGTLSAQYQIDLKNISYPKVEYIKMGNPGPAGQEIKVNNLYLTEGGV
PQVPVMGEFHYSRMDPRYWRDALLKMKSSGVNIVATYCLWSLHEEFEGELSWKDHLNLHR
FVELCKEVGLKVHLRIGPYCNAEIRNGGLPDWIVGNHNFRARSNDPLYLEYVRRWYEAVY
SQVKGMMYKDGGPVIAVQLENEYVVSGQIIPHLTALKNMAVEIGYDVPMYTMTHWLDSEY
PKGEIIPYAGFYIEAPWTTSGKNEVPVSNFEFFTYNRLSDNIGTDIIKIEGDVESLSGEN
NESPFFTCEVGVGSTTFYPRRAVVPEELAGENINLRLGCGANLMGYYMYVGGSNPVGQKR
TYQSSGPRISYDYQAPVREFGTLGTVMQETKKYNYFMNDFGPSLAPAVAYLPTSNQKREN
LQWAVRTDGKSGYLFCSNILYRRHRQDFKNVRFTVKLKDETLRIPRQRITVSDKAYFLWP
FNQSLGKTLLKYATVQPVCSMKEGNETTYFFFEDDGIAGEYFLSAEGIDKVETVHAACKK
EKNGWFINALRPGKDCVVTLNCTDGSIVRLVTLTEEESDQLWKGTNNGEDYVILTTSSLI
SDSKKITLIDEQSSAEAWIYGKGQFKKRTFQGEPRSLKATFRQLAPMDGAKAIRPVAGDL
VCRGFYLNTIAEVEKAWLRYVADKQSYSMLNNQKVQAEEMGGYWRADVTDLVKAGGNEWA
FSAPDGVMAELEILLSNGQRVIWNTDATWTSSDKRSVVTDCNLNKPSIFAEQEHLALYAV
NVPDALQGDEETRAYLSYKGDVANAYLNGALIGDSYYDGTDWILSPSRWKESAAVNPLIV
RIQGLKSADEPIYFEKDIHPADCVNPSLTGVEIRQEYRFPM

Enzyme Prediction     

No EC number prediction in MGYG000000273_01414.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	59	392	2.3e-82	0.9706840390879479

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	3.14e-53	59	394	6	309	Glycosyl hydrolases family 35.
PLN03059	PLN03059	5.71e-29	59	381	41	325	beta-galactosidase; Provisional
COG1874	GanA	4.63e-15	67	203	20	161	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	2.15e-08	79	203	12	138	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24325.1	0.0	1	881	1	881
QCQ52773.1	0.0	1	881	1	883
QCQ34970.1	0.0	1	881	1	883
QCQ48325.1	0.0	1	881	1	883
CBW24573.1	0.0	1	879	1	881

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3THC_A	4.01e-32	47	393	10	324	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	4.64e-32	47	393	34	348	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]
3WF3_A	1.09e-31	47	393	34	348	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]
7KDV_A	7.94e-31	59	393	29	331	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]
4E8C_A	8.06e-29	67	231	22	185	Crystalstructure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q93Z24	1.24e-32	31	492	39	497	Beta-galactosidase 17 OS=Arabidopsis thaliana OX=3702 GN=BGAL17 PE=2 SV=1
Q9TRY9	5.76e-32	51	425	39	390	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3
Q60HF6	6.27e-32	47	393	33	347	Beta-galactosidase OS=Macaca fascicularis OX=9541 GN=GLB1 PE=2 SV=1
P16278	2.52e-31	47	393	33	347	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2
Q5R7P4	3.36e-31	47	393	33	347	Beta-galactosidase OS=Pongo abelii OX=9601 GN=GLB1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000865	0.998036	0.000427	0.000231	0.000219	0.000207

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000273_01414.