CAZyme Information: MGYG000000273_02344

Basic Information

• Species: Phocaeicola coprophilus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola coprophilus
• CAZyme ID: MGYG000000273_02344
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378		42457.71	6.0873

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000273	3492533	Isolate	China	Asia

• Gene Location: Start: 32435; End: 33571 Strand: +

Full Sequence      

MKGIKTVLIGAGYRGQRLLRLMQGIEAYNVTAVFDPAAVFHTDGMLEVYTEGPEDYKRMI
AVQHPELVVIASPWHFHVEQALYALEQGCHVAMEIKGGFCLGEYDPLIEVASRKGLRIYP
LENAVFTRENMAMLQLVQAGVLGQLVALRGGYRHDLRDMLVDEQGNLGNPNKPEGIWRSR
FYLTENGDLYPTHGLAPLCLAAGVGRTDRIAELTSFSSRACGLNEFVAHRGGTSPLPVSM
GDIVITQMRTEAGVLITLTHDTTLPRPRSLDFELQGSKGIWRGEFRQIYVEGESPYETWE
DDEKYIARYEHICWQKWGKEALIQDVHHQGMDYIMLRMLAADFRGEMTYPITAGDLALWT
SVSPYSKLSIAGKRTVFL

Enzyme Prediction     

No EC number prediction in MGYG000000273_02344.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	2	374	4.6e-106	0.949874686716792

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	4.49e-14	1	378	1	340	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	2.17e-10	4	94	1	92	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK10206	PRK10206	7.81e-04	66	146	66	146	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24037.1	8.13e-287	1	378	1	378
QUT33801.1	1.34e-160	1	378	1	378
QQA30653.1	1.34e-160	1	378	1	378
QUT62197.1	1.34e-160	1	378	1	378
ADV42950.1	6.30e-158	4	378	10	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	6.40e-70	2	376	19	420	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	4.66e-37	4	371	43	422	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	3.51e-69	2	376	19	420	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	1.93e-67	4	371	34	425	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A4Q8G1	2.10e-66	9	371	58	443	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A6LB54	8.61e-60	47	371	103	441	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4FN60	2.26e-51	4	361	61	420	Glycosyl hydrolase family 109 protein OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=SACE_6314 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000273_02344.