CAZyme Information: MGYG000000273_02445

Basic Information

• Species: Phocaeicola coprophilus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola coprophilus
• CAZyme ID: MGYG000000273_02445
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362		42597.79	6.5119

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000273	3492533	Isolate	China	Asia

• Gene Location: Start: 4045; End: 5133 Strand: +

Full Sequence      

MRTFILLLLMQLVSLPFSYARQPEHSTYLVAHDLKSLDYVRQIDYAQFDYIYLMAAPNWK
EYDFSKSGEEIIRDLVTNHAFRKDQGVDVIRELIAQARACQTKVLLSFAGEGFRERVEDP
ALRAKFVDFMVAFIDKYDFDGIEVDWETAVTLPLHEVFVKDIREKLNVLESRKNRKMYLT
TALHSWQRYSKELAEKVSRSLDWINIMTYDMGGGIWGNVPTHNTPLDRIITDLKAWEMFD
KSKLCIGLANYGFFYKGIKPGQKIEGKLDKYGRYIGYNEAMAVFSSDWKEVKDPQAKVSY
FINEKQQEFITLETKETIRTKAEWVKENGFRGAFWWEFSYDEILPDSKDGKIRHHLIDEI
KW

Enzyme Prediction     

No EC number prediction in MGYG000000273_02445.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	46	343	4.7e-51	0.8581081081081081

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	2.40e-45	103	341	86	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	2.42e-44	103	341	68	334	Glyco_18 domain.
pfam00704	Glyco_hydro_18	5.10e-40	94	341	56	307	Glycosyl hydrolases family 18.
COG3325	ChiA	8.47e-34	103	342	128	424	Chitinase, GH18 family [Carbohydrate transport and metabolism].
cd02872	GH18_chitolectin_chitotriosidase	9.69e-33	101	336	70	336	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO25976.1	3.75e-268	1	362	1	362
BCI61687.1	1.63e-148	20	361	20	361
QHI70666.1	2.20e-93	25	360	33	372
BBL02594.1	8.10e-91	1	358	1	365
BBL10471.1	3.67e-89	19	358	19	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KST_A	1.86e-24	112	341	90	357	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXN_A	1.86e-24	112	341	90	357	Crystalstructure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXM_A	9.00e-24	112	341	90	357	Crystalstructure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXM_B Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6BT9_A	4.65e-21	96	341	152	448	ChitinaseChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
1ITX_A	8.08e-20	103	341	124	406	ChainA, Glycosyl Hydrolase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	9.02e-19	103	341	156	438	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
Q95M17	1.33e-15	101	343	89	367	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
Q13231	2.35e-15	107	347	100	369	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
Q91XA9	7.76e-15	98	349	86	373	Acidic mammalian chitinase OS=Mus musculus OX=10090 GN=Chia PE=1 SV=2
Q6RY07	1.44e-13	98	349	86	373	Acidic mammalian chitinase OS=Rattus norvegicus OX=10116 GN=Chia PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000205	0.999178	0.000154	0.000156	0.000142	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000273_02445.