CAZyme Information: MGYG000000273_02547

Basic Information

• Species: Phocaeicola coprophilus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola coprophilus
• CAZyme ID: MGYG000000273_02547
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297	MGYG000000273_33|CGC1	34660.79	10.1611

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000273	3492533	Isolate	China	Asia

• Gene Location: Start: 25250; End: 26143 Strand: -

Full Sequence      

MRRLNIHSILLALCLLSGMTLGAQTRNRAYEEYIEKYREVAIEEMKRYHIPASITLAQGL
LESGAGRSELARKSNNHFGIKCGSTWEGRTVRHNDDAPRECFRAYRHARESYRDHSKFLS
TGARYAFLFRLKITDYKGWARGLKKAGYATDPRYAQRLIDIIELYDLDKYDRKDGLKWAK
ENPNPHQSYLANELVYVIARKGDTFKSLGKELDISHRKLRKYNELPKDYELKGGEIIYIE
EKKKRADKDHIVYVVRSGDSMYSISQKFGIRLKNLYKMNRMNPESPAPKVGDILRLR

Enzyme Prediction     

No EC number prediction in MGYG000000273_02547.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	40	167	4e-37	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	5.91e-40	4	172	11	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	7.59e-40	31	171	161	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
smart00047	LYZ2	2.44e-29	27	171	5	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	7.16e-28	39	167	2	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
TIGR02541	flagell_FlgJ	2.41e-27	23	162	133	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO23242.1	7.63e-217	1	297	1	297
ADY34780.1	2.62e-161	6	297	50	341
QEW37663.1	6.02e-159	14	297	14	297
QQY37845.1	6.24e-159	14	297	15	298
QQY41126.1	6.24e-159	14	297	15	298

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	3.55e-14	50	162	21	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	4.28e-14	50	162	22	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	2.92e-13	50	162	22	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5T1Q_A	1.56e-10	50	171	80	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	8.94e-10	50	163	23	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.58e-17	46	171	64	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P37710	1.30e-15	17	279	167	457	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q9X9J3	3.47e-13	31	161	161	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	7.14e-11	33	176	164	318	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q9I4P4	2.97e-10	31	161	240	381	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.008688	0.978924	0.011377	0.000443	0.000281	0.000250

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000273_02547.