CAZyme Information: MGYG000000277_00194

Basic Information

• Species: Streptococcus mutans
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus mutans
• CAZyme ID: MGYG000000277_00194
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
979	MGYG000000277_1|CGC3	107323.11	5.6731

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000277	2020595	Isolate	China	Asia

• Gene Location: Start: 201152; End: 204091 Strand: -

Full Sequence      

MKSKTYLMIPLALTLFMAANKISADEQNQSLSASEVISSDATSVSELPATTAQISQEVRN
NGQDSTIQLQQTQEQSDPITSTSETTVSSMKAVTNGSPAKANETETVPSQASTASSVQTP
DQISTVPSVKAETTSTADQLQSTSSAPLDQQTDAKRLSNKMTPASSVQARSSLTQDKQVQ
AQEVTSAVVEEKGIKLQYNGQIARNTKIQFAVWSARNDQDDLQWYTANNMGAAYAEFKNH
REYGTYYVHTYANQNGKMIGLNATTLTIAQPQVQTNIQRKSATNFELTVSNVPNTISSIM
VPVWSDQNGQDDIKWYNARKADDGSYKVLIDTKNHKNDLGHYEAHIYGYSTVTQSQIGLA
VSSGFDRNDTRPNARISVADYDQNKTTFDVVVEGSSDTKTVSAVNIAVWSEDKGQDDLKW
YSPKIVNNKATVTINIANHSNTSDKYNVHVYTDYTDGTHSGTILGAYQINKPLEKNTVSA
DLTSDGIALKLDSNTVTDYTKVRFAVWSDQNGQDDLKWYSANSDGAATAAYSNHSGYGLY
HIHTYIIKDGKMVGLNGRTITINQPSAKVDIAKESDALYKVTVSNLPAYISSVVIPVWTD
KNNQDDIQWIPATKQGDGTYAAQIQLADHNGETGHYNVHVYGQSKFDNKTVGLAATDGFN
VAETRNAVIAASNYNASAGTIDMIVKQEAGGKAIKEVRIAAWSEADQSNLHWYVSSTIID
GKVIVTINEKNHQYIKGNYNIHVYVDYTDGTSSGTNIGNYSLNADKPAVALPSYFIDISS
HNGIISVAEFNSLKQQGIQGVVVKLTEGTSYINPYASSQIANARVAGIKVSAYHYAHYTS
AAGAQEEARYFANAARSFGLEASTVMVNDMEESSMVNNINNNVQAWQDEMRRQGYSNLIH
YTMASWLDIRGGQVDTARFGINNFWVAHYAKGYTYMTQEEAKSLNYYANAAAWQYTSVSS
KLSHTLDENIDYTGRFTQQ

Enzyme Prediction     

EC	3.2.1.17

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	776	957	3.8e-42	0.9548022598870056

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06522	GH25_AtlA-like	2.10e-82	773	972	1	192	AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.
pfam01183	Glyco_hydro_25	3.00e-50	776	960	1	176	Glycosyl hydrolases family 25.
cd00599	GH25_muramidase	1.71e-39	774	970	1	185	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam08481	GBS_Bsp-like	2.25e-27	378	465	1	89	GBS Bsp-like repeat. This domain is found as a repeat in a number of Streptococcus proteins including some hypothetical proteins and Bsp. Bsp is a protein of group B Streptococcus (GBS) which might control cell morphology.
pfam08481	GBS_Bsp-like	7.45e-26	569	656	1	89	GBS Bsp-like repeat. This domain is found as a repeat in a number of Streptococcus proteins including some hypothetical proteins and Bsp. Bsp is a protein of group B Streptococcus (GBS) which might control cell morphology.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARS62104.1	0.0	1	979	1	979
BAO79754.1	0.0	1	979	1	979
VEF18801.1	0.0	1	979	1	979
QIR00338.1	0.0	1	979	1	979
QIQ94101.1	0.0	1	979	1	979

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KRU_A	3.89e-06	776	929	23	170	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	8.57e-06	776	929	23	170	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000665	0.997699	0.001016	0.000215	0.000200	0.000174

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000277_00194.