CAZyme Information: MGYG000000277_01725

Basic Information

• Species: Streptococcus mutans
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus mutans
• CAZyme ID: MGYG000000277_01725
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
195	MGYG000000277_5|CGC2	21883.32	9.8457

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000277	2020595	Isolate	China	Asia

• Gene Location: Start: 108684; End: 109271 Strand: -

Full Sequence      

MRARLKFKSFVVIVLLLLLVILLPILASGGLADANKKMPSPYSHKEFVKEIAPTAQKLSK
IYGVRSSIIIGQAALDSHFGSTLLASKYHNLFSIEASPGQGAVRLKSHEYKNGRWQEVTN
RYLVYESWKESLYDYMAILHGNKIWDKALYTTMMTSSGYKTVARALQAAGFNSDPNYADK
LIAVIEENNLTDYDK

Enzyme Prediction     

No EC number prediction in MGYG000000277_01725.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	52	190	1.4e-26	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	5.67e-49	28	195	25	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	2.83e-42	37	186	1	137	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK05684	flgJ	5.34e-22	34	185	142	294	flagellar assembly peptidoglycan hydrolase FlgJ.
PRK08581	PRK08581	7.86e-21	47	195	323	473	amidase domain-containing protein.
PRK12713	flgJ	5.27e-19	46	187	183	325	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT16678.1	7.55e-130	1	195	1	195
QFG40204.1	7.55e-130	1	195	1	195
BAQ19579.1	7.55e-130	1	195	1	195
QIR04627.1	7.55e-130	1	195	1	195
BBK79310.1	7.55e-130	1	195	1	195

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	3.40e-17	40	194	26	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	4.30e-16	45	187	4	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	5.90e-16	45	187	4	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	2.36e-15	47	190	4	148	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	2.84e-15	47	190	5	149	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	9.06e-22	47	195	51	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P58231	4.49e-15	41	187	146	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
P75942	4.49e-15	41	187	146	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
P15931	2.27e-14	45	187	153	296	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
Q9CIT4	3.77e-14	43	194	61	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.390388	0.602381	0.004717	0.000874	0.000536	0.001090

TMHMM  Annotations     

start	end
9	31