CAZyme Information: MGYG000000278_00554

Basic Information

• Species: UBA3402 sp003478355
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA3402; UBA3402 sp003478355
• CAZyme ID: MGYG000000278_00554
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000000278_3|CGC1	43626.71	4.6044

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000278	4338723	Isolate	China	Asia

• Gene Location: Start: 10111; End: 11238 Strand: +

Full Sequence      

MEILDRYIDQLLEKSSPQAPIWNIEKIRQGAKPSWNYIDGCMINAILELYHIKKNPAYLE
FADAFIDYFVCEDGSILSYDPKEYNLDNVNAGKTLFDLYKLTGKAKYRKAMDTVYSQLQG
QPRTSTGNFWHKLIYPNQIWLDGLYMAQPFYMQYELTFNDGKNCEDSYQQFLTVYDKMRD
LRNGLYYHAYDDSRESFWCDKVTGLSDNFWLRALGWYAMALIDTMEVMPESMKEEKETLG
RIYHELIDSMLPYQDEETGMWYQVVNRGGIRPNYLETSGSAIFAYAIMKSVRLGFLDDSY
FVYGKKAFDGICKKYLSEENGELQLGGICLVAGLGNKEMREGTFDYYMREPVVKNEAKGV
APLILAYVEVLMTEQ

Enzyme Prediction     

No EC number prediction in MGYG000000278_00554.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	29	371	6.6e-112	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	6.29e-88	32	374	31	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.24e-84	35	373	27	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG1331	YyaL	0.010	42	127	473	580	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU47524.1	2.57e-227	1	375	1	375
QQR03578.1	2.57e-227	1	375	1	375
QIX91776.1	5.19e-227	1	375	1	375
QRP36827.1	9.53e-223	1	371	1	371
ASN98361.1	9.53e-223	1	371	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	2.23e-100	35	369	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	9.43e-63	35	369	39	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.98e-62	35	369	29	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	1.01e-08	122	324	146	340	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	9.86e-07	122	371	147	378	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	5.16e-62	35	369	39	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	4.86e-41	146	372	1	230	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	4.86e-41	146	372	1	230	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000278_00554.