CAZyme Information: MGYG000000278_01109

Basic Information

• Species: UBA3402 sp003478355
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA3402; UBA3402 sp003478355
• CAZyme ID: MGYG000000278_01109
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	MGYG000000278_6|CGC3	41563.58	4.6229

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000278	4338723	Isolate	China	Asia

• Gene Location: Start: 93764; End: 94840 Strand: +

Full Sequence      

MNRENYETVLRRVSDRMMNMKQDGIQEKYPISLLDMEAWEWPQGVGLYGLFRYYKTSKDE
DILKFLIRWYDDRIAEGLPEHNVNTTAPMLTLLCLYEETGKDGYLKEIKDWARWIMEDGG
LIRTGDGLFQHMITGDPNADEILIDTLFMTVLFLAKAGVLLKRQDYIDEANFQILQHIKY
LLNKQEGLFYHGFNFKRNDNYGEVLWGRGNCWYTIVLMDYLETIPVDESLKRYFLSVYRN
QVAALKKYADKETGLWHTVINDADTYLELSASSGFLAGIMHGIRSGYLKMEEYQVVVDKA
LGNLDSYIDADGTVLQVSYGTPIGLDEDFYKNIPCYPMTYGQAMMILALQEAMIYQSK

Enzyme Prediction     

No EC number prediction in MGYG000000278_01109.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	36	352	1.8e-92	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	6.85e-92	1	353	11	350	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.33e-83	9	351	1	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET87383.1	1.22e-168	7	353	8	354
BCJ94867.1	4.62e-168	2	354	3	355
AGX06452.1	6.06e-128	13	358	15	357
ANY67857.1	1.57e-124	12	353	13	350
QLG41208.1	1.80e-123	12	353	13	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	1.87e-85	3	351	23	375	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	5.45e-85	3	351	24	376	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	7.18e-71	39	351	47	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
1NC5_A	9.42e-22	39	351	39	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.01e-21	39	351	29	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	8.60e-49	38	353	28	336	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	5.16e-21	39	351	39	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
L7P9J4	4.95e-08	145	351	163	372	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000278_01109.