CAZyme Information: MGYG000000278_01159

Basic Information

• Species: UBA3402 sp003478355
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA3402; UBA3402 sp003478355
• CAZyme ID: MGYG000000278_01159
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
233	MGYG000000278_7|CGC1	26691.67	6.8325

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000278	4338723	Isolate	China	Asia

• Gene Location: Start: 742; End: 1443 Strand: -

Full Sequence      

MLLKFRLLKEYKELYQSIGLYEENELKINAFVLSVAKDGNVAIPMSRNRKKLDKEDYIED
PLPPGYTRVKHSFSPVYDADCRLLILGSFPSVKSREENFYYGHPQNRFWKLMARLLKEPL
PVSVEEKKAMLLKHHIAIWDVVAECDIHGSSDGSIRNVIPTNLNQILREADIQTIIANGT
AAYTLYHTYCEDHTGRTAVKCPSTSPANAVFTLDRLEDAWGKVFLDLYPQLDL

Enzyme Prediction     

No EC number prediction in MGYG000000278_01159.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10032	UDG-F6_HDG	5.91e-70	71	209	1	141	Uracil DNA glycosylase family 6, includes hypoxanthine-DNA glycosylase and similar proteins. Uracil DNA glycosylase family 6 hypoxanthine-DNA glycosylase (HDG) lacks any detectable UDG activity; it excises hypoxanthine, a deamination product of adenine, from double-stranded DNA. Uracil-DNA glycosylase (UDGs) initiates repair of uracils in DNA. Uracil in DNA can arise as a result of misincorporation of dUMP residues by DNA polymerase or via deamination of cytosine. Uracil in DNA mispaired with guanine is one of the major pro-mutagenic events, causing G:C->A:T mutations. Thus, UDG is an essential enzyme for maintaining the integrity of genetic information. UDGs have been classified into various families on the basis of their substrate specificity, conserved motifs, and structural similarities. Although these families demonstrate different substrate specificities, often the function of one enzyme can be complemented by the other.
TIGR04274	hypoxanDNAglyco	1.40e-41	72	220	1	150	hypoxanthine-DNA glycosylase. Members of this protein family represent family 6 of the uracil-DNA glycosylase superfamily, where the five previously described families all act as uracil-DNA glycosylase (EC 3.2.2.27) per se. This family, instead, acts as a hypoxanthine-DNA glycosylase, where hypoxanthine results from deamination of adenine. Activity was shown directly for members from Methanosarcina barkeri and Methanosarcina acetivorans.
COG3663	Mug	9.82e-29	73	227	2	164	G:T/U-mismatch repair DNA glycosylase [Replication, recombination and repair].
smart00986	UDG	7.95e-11	78	220	5	152	Uracil DNA glycosylase superfamily.
cd10028	UDG-F2_TDG_MUG	5.41e-10	80	220	8	159	Uracil DNA glycosylase family 2, includes thymine DNA glycosylase, mismatch-specific uracil DNA glycosylase and similar proteins. Uracil DNA glycosylase family 2 consists of thymine DNA glycosylase (TDG), which removes uracil and thymine from G:U and G:T mismatches in double-stranded DNA. It includes mismatch-specific uracil DNA glycosylase (MUG), the prokaryotic homolog of TDG. Escherichia coli MUG is highly specific to G:U mismatches but also repairs G:T mismatches at high enzyme concentration. Uracil-DNA glycosylases (UDGs) initiate repair of uracils in DNA. Uracil in DNA can arise as a result of misincorporation of dUMP residues by DNA polymerase or via deamination of cytosine. Uracil in DNA mispaired with guanine is one of the major pro-mutagenic events, causing G:C->A:T mutations. Thus, UDG is an essential enzyme for maintaining the integrity of genetic information. UDGs have been classified into various families on the basis of their substrate specificity, conserved motifs, and structural similarities. Although these families demonstrate different substrate specificities, often the function of one enzyme can be complemented by the other..

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU21468.1	2.80e-113	3	222	229	448
ASN94231.1	3.96e-113	3	222	229	448
QRP41091.1	3.96e-113	3	222	229	448
ANU48636.1	1.13e-112	3	222	229	448
QQR02463.1	1.13e-112	3	222	229	448

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46EH7	9.92e-12	70	179	3	114	Hypoxanthine DNA glycosylase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) OX=269797 GN=Mbar_A0737 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000278_01159.