CAZyme Information: MGYG000000278_03056

Basic Information

• Species: UBA3402 sp003478355
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA3402; UBA3402 sp003478355
• CAZyme ID: MGYG000000278_03056
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675	MGYG000000278_31|CGC1	78550.87	4.8628

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000278	4338723	Isolate	China	Asia

• Gene Location: Start: 40636; End: 42663 Strand: +

Full Sequence      

MRFEEKDGALLAYHQGEMLRIESWGEDSLRVRATKLGGFTNEDWALTEPVPAGNAVVEIG
EMDHRLSSGVVEKRPMAVITNGRIQAKVNFAGVITFYRDGTVFLQEYFRNYDGTISRESR
CLKVINREWKGIIGGSESKLIVKFESNDGEKIFGMGQYQHSYMDLKGCTLELEQRNSQIS
VPFMVSSYGYGMLWNNPAVGQVTFGKNYTEWNARSTRQMDYWLTVADTPKKILEQYTEVT
GRAPGFPEDRMGLWQCKLRYRTQKEVLEVARRYQKEGIHIDQIVIDFFHWTLQGDWKFDR
KYWPDPKAMIDELHSMGIKVMVSVWPSVDKKSENFGPMMDRGLLIQTERGAVQTYDYQGD
CMEIDALNPETRKYVWEVCKKNYYDLGVDGFWLDNSEPDFAVYDHENYRYFAGPALTCSN
IYPQMYSRVFFDPMKKMGNDAVVNLLRCAWAGSQKYGNVVWSGDVPSTFEAFYDQLQAGL
NMGLAGIPWWTTDIGGFMTDDWEDPDFKQLLIRWYQFAVYSPVLRMHGERGPINIPPLDD
RDWGGGYLHTGHSNELWSYGEENYRIMKHYYEVRMAMKEYIKGLFEEASENGSPLLRAMF
YEFPEDPKCWELQDQYMFGDRYLVAPVFHLNQWQREVYLPEGTWRDTRDGKNYEGGQLIM
VEAPLETIPVFEKVD

Enzyme Prediction     

No EC number prediction in MGYG000000278_03056.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	221	673	1.5e-136	0.9859484777517564

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1501	YicI	6.65e-158	17	673	24	665	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06591	GH31_xylosidase_XylS	8.71e-150	241	574	1	322	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.
pfam01055	Glyco_hydro_31	2.77e-136	227	671	6	435	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
PRK10658	PRK10658	9.28e-64	180	657	195	647	putative alpha-glucosidase; Provisional
PRK10426	PRK10426	5.42e-61	100	675	44	620	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIF26052.1	0.0	1	675	1	671
BCJ98925.1	0.0	1	673	1	672
AHF24694.1	0.0	1	674	9	682
ACZ98613.1	0.0	1	674	1	674
QTE68763.1	0.0	1	673	1	665

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DRU_A	6.00e-98	3	671	3	704	Xylosidasefrom Aspergillus niger [Aspergillus niger],6DRU_B Xylosidase from Aspergillus niger [Aspergillus niger]
5JOU_A	1.34e-77	211	671	367	837	Bacteroidesovatus Xyloglucan PUL GH31 [Bacteroides ovatus],5JOV_A Bacteroides ovatus Xyloglucan PUL GH31 with bound 5FIdoF [Bacteroides ovatus]
7KMP_A	9.26e-72	143	671	179	858	ChainA, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306],7KNC_A Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306]
2XVG_A	4.35e-68	217	673	401	869	crystalstructure of alpha-xylosidase (GH31) from Cellvibrio japonicus [Cellvibrio japonicus],2XVK_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with 5-fluoro-alpha-D-xylopyranosyl fluoride [Cellvibrio japonicus],2XVL_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with Pentaerythritol propoxylate (5 4 PO OH) [Cellvibrio japonicus]
6JR6_A	2.32e-64	130	673	137	683	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q01336	4.10e-184	17	532	18	527	Uncharacterized family 31 glucosidase ORF2 (Fragment) OS=Pseudescherichia vulneris OX=566 PE=3 SV=1
Q9P999	2.16e-98	143	671	105	615	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
A2QTU5	5.00e-97	3	671	21	722	Alpha-xylosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axlA PE=1 SV=1
A7LXT0	7.25e-77	211	671	366	836	Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02646 PE=1 SV=1
Q9F234	3.52e-60	147	673	144	669	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000278_03056.