CAZyme Information: MGYG000000278_03099

Basic Information

• Species: UBA3402 sp003478355
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA3402; UBA3402 sp003478355
• CAZyme ID: MGYG000000278_03099
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
566	MGYG000000278_32|CGC1	63333.69	5.1417

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000278	4338723	Isolate	China	Asia

• Gene Location: Start: 26257; End: 27957 Strand: +

Full Sequence      

MVDLRKKPYYLSEEQVQWVEDTINSMTIEEKIGQLFVNMVTDRSPEALKEVVDTYHPGAI
RYQNAPADVLYDQNKTLQEASRIPLLIASNCEQGGNGGVGGGTPIACGAAIASTGDEENA
YLMAKVGAAESWAVGCNWNFAPIVDLTYNWRNTIVQIRAFNNVPDDVIRYSKAFFKGTKT
REMATCMKHFPGDGTEENDQHLIMGVNEMSCEEWDQTYGKVYKALIEEGVMTVMAGHIAL
PAYSRKLRPGIKDVDIRPATLAPELITDLLKGQLGFNGLVVTDASHMIGMFGATVPRSEQ
VPGAIAAGCDMFLFFNDREEDFGYMMEGYKNGTITEERLNDALHRILGLKAALNLHIHKK
EGTLMPPKEGLSVVGCLEHHQIAAQIADQYVTLVKDRENYLPMTPEKYKRIKLVFIGGEG
RVIAGQLLKGNDEVIKADVIRQLEEAGFEVDAEEPVLKGKMEEFKKRFDAVLLILSVEGF
AQYNVMRVKWNLPIKQPWYMSEVPTIVASLTYPNMLIDVPMARCYANAYMNHPEAVHALI
EKLMGRSEFKGAYNDNVFCGRWETRF

Enzyme Prediction     

No EC number prediction in MGYG000000278_03099.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	78	313	2.8e-49	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	4.73e-56	26	440	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.05e-54	27	349	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	2.77e-29	117	319	100	284	beta-hexosaminidase; Provisional
PRK15098	PRK15098	3.65e-18	19	414	38	416	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW79114.1	1.94e-312	1	566	1	569
QIB54599.1	1.94e-312	1	566	1	569
QBE97674.1	3.92e-312	1	566	1	569
AQM60421.1	8.58e-287	1	565	1	564
QTQ13616.1	4.68e-285	1	566	1	569

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	2.66e-128	7	565	9	566	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
3BMX_A	9.94e-40	23	414	39	458	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	3.64e-39	23	414	13	432	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	4.83e-39	23	414	43	462	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	4.61e-34	25	551	10	525	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	1.11e-127	1	564	1	562	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	5.44e-39	23	414	39	458	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
Q7NWB7	2.89e-24	116	320	95	290	Beta-hexosaminidase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=nagZ PE=3 SV=1
P96157	3.61e-21	117	319	95	277	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=nagZ PE=1 SV=2
A1SW90	4.06e-21	118	318	95	282	Beta-hexosaminidase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000278_03099.