CAZyme Information: MGYG000000279_00082

Basic Information

• Species: Veillonella sp003463825
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella; Veillonella sp003463825
• CAZyme ID: MGYG000000279_00082
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371		42934.92	7.4761

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000279	2005377	Isolate	China	Asia

• Gene Location: Start: 79550; End: 80665 Strand: +

Full Sequence      

MCAHNEEAVVGELVKNLRSLDYPDELYDIFVVADNCTDKTAEVASAAGANVHERFNKEEV
GKGYAMGWMFDRVEKMDRKYDAFLIFDADNLVHPQFMLEMNDHLEKGESVIQGYLNSKNP
TDSWVAGTFSIMFWMVNHMWHLAKYRIGLSTALGGTGMCIRTSIIREYGWDCNSLTEDME
FSMKLLTHGLKTTWAHDAIVYDEKVTTMMASCKQRLRWAQGQFDCADRYIPKLFAAGIKQ
GNIVILDGILQVSQPYFLLLTTIYLVFSYINAYVPIYTNILYQIMPMSVWQIIGIGQYLF
PLIVLLKIKVPPKIWFYYLLYPIFVYSWVPVNILGWFRRHNKEWSHTVHTRAVGLNDVKL
TRMGNMNKNKK

Enzyme Prediction     

No EC number prediction in MGYG000000279_00082.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	2	219	2.3e-28	0.9521739130434783

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	3.86e-94	2	181	4	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
cd06423	CESA_like	1.22e-40	3	178	5	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	3.90e-37	1	336	60	403	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13641	Glyco_tranf_2_3	6.38e-24	2	221	9	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
pfam13632	Glyco_trans_2_3	1.66e-21	83	285	2	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBU34338.1	3.08e-279	1	371	50	420
BBU36277.1	3.08e-279	1	371	50	420
ARF99390.1	1.15e-274	1	371	50	420
VEG93415.1	3.37e-267	1	371	50	420
CAB1275536.1	1.46e-261	1	371	50	420

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8YMK0	2.08e-13	1	224	112	336	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
P96587	4.33e-13	3	234	57	292	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q3MB01	1.59e-12	1	224	112	336	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
P74165	9.22e-12	1	224	114	338	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999983	0.000022	0.000009	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
252	274
287	304
314	336