CAZyme Information: MGYG000000279_01431

Basic Information

• Species: Veillonella sp003463825
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella; Veillonella sp003463825
• CAZyme ID: MGYG000000279_01431
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
275	MGYG000000279_39|CGC1	30795.89	6.5848

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000279	2005377	Isolate	China	Asia

• Gene Location: Start: 15242; End: 16069 Strand: -

Full Sequence      

MKVMFSAGEASGDTHAASVANALKEIDPSVDMFGMGGTLMERAGVRIVYDIKNLGVIGIV
EIVKSLPKFFKLRTYLKRVMMKEKPDILVCVDYPGFNMKLAAVAHELGIPVLYYIAPTIW
AWHSSRGNTIRKYVTKVASIFPFEAEAYRKYKCDVEFVGHPLLDIVHPTMTKDEAEEYFG
ARKEAKKVLLMPGSRKQEVLSLLDTMLKSGEQLMANHEDIQFFLPRAHTIDRSELETFID
AHKVPVTITEDHTYDLMQICDVCLAASGTATLETA

Enzyme Prediction     

No EC number prediction in MGYG000000279_01431.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	275	3.8e-93	0.7598870056497176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.75e-103	1	275	2	277	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	5.67e-84	1	275	2	280	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	5.55e-70	3	275	1	277	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.40e-58	3	275	8	283	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK01021	lpxB	5.59e-37	6	275	232	504	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBU36764.1	1.56e-198	1	275	1	275
BBU34833.1	1.56e-198	1	275	1	275
VEG93955.1	3.50e-195	1	275	1	275
SNU95574.1	4.74e-193	1	275	1	275
ACZ24221.1	4.74e-193	1	275	1	275

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.90e-38	1	273	7	281	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.01e-37	1	273	7	281	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q74AT9	1.21e-74	2	275	8	281	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
B3E4H8	6.65e-71	2	275	8	281	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q39T49	3.05e-69	2	275	8	281	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q2LVL8	1.18e-68	3	275	6	279	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q3A550	6.67e-67	2	275	9	283	Lipid-A-disaccharide synthase OS=Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1) OX=338963 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000279_01431.