CAZyme Information: MGYG000000281_00984

Basic Information

• Species: Lachnoclostridium_A sp003464085
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium_A; Lachnoclostridium_A sp003464085
• CAZyme ID: MGYG000000281_00984
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
265	MGYG000000281_5|CGC1	30411.15	4.4203

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000281	4359604	Isolate	China	Asia

• Gene Location: Start: 138942; End: 139739 Strand: +

Full Sequence      

MDTRKEMAPEGQEDQKKPDGPLEDNGLDEGQAEAGQEGAAGEAYESNMEEMPEGESEEWE
EEDDGEESYGRPNIAVRFFCIVFKYLKIIFRPLFKLLGFLFRSLFILCVVVLVAVIGIGA
YKVYPLYTEYKKEAVQMVADSSLDTFRLQESSFIYDRQGNVIAKLTKDEDSDYLPYDTIP
ENAVNAFVAIEDRTFWDNSGYDLRGIIRVALNYFKTDGEEVHGASTITQQLARNRFLTRE
VQSNEKLRKSSFPWSLRKNIRKNRL

Enzyme Prediction     

EC	2.4.1.129

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	159	264	7.5e-27	0.5819209039548022

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	1.09e-26	91	240	5	145	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	8.82e-26	158	240	1	81	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	1.81e-25	93	241	1	136	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	5.31e-17	104	240	7	134	penicillin-binding protein 1a; Provisional
PRK00056	mtgA	1.02e-14	90	249	2	134	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK77227.1	9.05e-36	101	248	138	282
CBK80882.1	1.02e-34	102	246	68	212
BAK46854.1	5.26e-29	117	247	79	215
BCD34019.1	6.52e-25	110	265	33	188
QMW72903.1	6.52e-25	110	265	33	188

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	7.19e-15	173	250	22	98	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	2.62e-14	173	250	22	98	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
7U4H_A	5.14e-11	150	250	19	116	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
5U2G_A	3.96e-10	142	240	12	108	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
5ZZK_A	1.48e-07	162	265	47	149	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40750	2.44e-17	110	265	11	169	Penicillin-binding protein 4 OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpD PE=1 SV=2
O66874	2.59e-14	143	250	36	141	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
Q0SRL7	1.62e-13	148	265	68	188	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1
Q8XJ01	2.77e-13	113	265	43	188	Penicillin-binding protein 1A OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=pbpA PE=3 SV=1
Q0TNZ8	2.95e-13	113	265	43	188	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
99	121