CAZyme Information: MGYG000000281_01002

Basic Information

• Species: Lachnoclostridium_A sp003464085
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium_A; Lachnoclostridium_A sp003464085
• CAZyme ID: MGYG000000281_01002
• CAZy Family: GH18
• CAZyme Description: Spore germination protein YaaH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
288		32962.49	4.6961

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000281	4359604	Isolate	China	Asia

• Gene Location: Start: 156956; End: 157822 Strand: +

Full Sequence      

MISEADLYQVRPMLTLTPLGEDGHFNNMLITGLVNNMETQERLIWNLGLTVTEKGYGGVN
VDFEYILPEDRDQFSAFVGRLTRVMNQFGYRVSVALAPKTSRNQQGLLYEGVDYKALGEA
ANEVFVMAYEWGYTYGPPMAVAPLNMVRRVLDYALTEIPGNKIILGMPNYGYDWPLPYER
GTTKARTMGNIEAVQLAIGYGVPIRFDETAQSPYFHYWQYGIQHEVWFEDPRSVRAKLNL
VEEYGLKGAGYWQLMQLFRASWLLMEDQFLINKQSDQTGDVRNRSIDG

Enzyme Prediction     

No EC number prediction in MGYG000000281_01002.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	30	256	1.5e-37	0.706081081081081

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	9.88e-106	1	265	50	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	2.51e-86	10	269	161	422	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	1.18e-23	12	262	61	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
smart00636	Glyco_18	2.59e-23	9	254	66	331	Glyco_18 domain.
pfam00704	Glyco_hydro_18	6.73e-23	33	254	82	304	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV19273.1	3.53e-140	1	275	106	380
ADL06657.1	3.53e-140	1	275	106	380
QJU19362.1	1.87e-139	1	273	106	378
QIX90177.1	1.87e-139	1	273	106	378
ASN96403.1	1.08e-138	1	273	106	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3K_A	1.45e-74	21	277	178	435	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4S3J_A	4.65e-72	9	276	166	432	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
3CZ8_A	1.08e-57	9	254	66	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
5JH8_A	4.02e-27	40	254	89	299	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4WIW_A	1.54e-22	33	252	90	327	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37531	1.90e-70	13	275	167	429	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
P0DPJ9	5.20e-70	12	274	168	429	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	1.46e-69	12	274	168	429	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
O05495	9.13e-58	9	273	158	419	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
O32258	6.46e-25	25	262	101	336	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000281_01002.