CAZyme Information: MGYG000000281_03186

Basic Information

• Species: Lachnoclostridium_A sp003464085
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium_A; Lachnoclostridium_A sp003464085
• CAZyme ID: MGYG000000281_03186
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319		36491.07	6.6959

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000281	4359604	Isolate	China	Asia

• Gene Location: Start: 25577; End: 26536 Strand: +

Full Sequence      

MGRTKKKKEVGTGFITEVDRYLYGNGTHYEIYEKLGAHPKTLRGKNGYYFAVWAPHAESV
SVVGNFNGWDPDSHPMTQLEQSGIYELFVPNLSKGELYKFAVTTTSGKILFKADPYAVTA
EYRPGTASITGDISGFSWKDEKWMEKRQTTEHVKEPMSIYEVHIGSWRKKNRPEKDGYYT
YKEVAKELADYVSSMGYTHVELMGIAEHPYDGSWGYQVTGYFAPTSRYGTPDEFMYLINY
LHKKGIGVILDWVPAHFPKDAHGLADFDGQPLYEYADPKKGEHPDWGTKVFDYGKNEVKN
FLISNALYWIEKFHVDGLV

Enzyme Prediction     

No EC number prediction in MGYG000000281_03186.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	190	318	6.8e-69	0.42524916943521596
CBM48	34	122	1.1e-21	0.9342105263157895

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05402	PRK05402	0.0	15	318	100	401	1,4-alpha-glucan branching protein GlgB.
PRK12313	PRK12313	2.37e-172	13	318	5	306	1,4-alpha-glucan branching protein GlgB.
TIGR01515	branching_enzym	3.88e-149	19	318	1	297	alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG0296	GlgB	1.68e-143	15	318	6	300	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK14705	PRK14705	1.50e-129	15	318	603	901	glycogen branching enzyme; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL02769.1	2.55e-186	7	318	5	316
QRV19017.1	2.55e-186	7	318	5	316
SEU02885.1	5.89e-185	7	318	5	316
QRP41890.1	1.44e-184	4	318	10	324
ASN93451.1	1.44e-184	4	318	10	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KLF_A	6.75e-122	14	318	104	427	ChainA, 1,4-alpha-glucan branching enzyme GlgB [Crocosphaera subtropica ATCC 51142]
5GR2_A	1.74e-121	14	318	128	451	Crystalstructure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GR4_A Crystal structure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GQW_A	1.74e-121	14	318	128	451	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR1_A	1.74e-121	14	318	128	451	Crystalstructure of branching enzyme Y500A/D501A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142],5GR6_A Crystal structure of branching enzyme Y500A/D501A double mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR0_A	1.74e-121	14	318	128	451	Crystalstructure of branching enzyme D501A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P30539	2.58e-141	14	318	6	310	1,4-alpha-glucan branching enzyme GlgB OS=Butyrivibrio fibrisolvens OX=831 GN=glgB PE=1 SV=1
Q2JT08	4.06e-127	15	318	117	434	1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain JA-3-3Ab) OX=321327 GN=glgB PE=3 SV=1
Q2JK68	2.11e-125	15	318	117	434	1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) OX=321332 GN=glgB PE=3 SV=1
Q608L5	1.29e-124	15	318	105	406	1,4-alpha-glucan branching enzyme GlgB OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) OX=243233 GN=glgB PE=3 SV=1
Q8DLB8	1.00e-123	15	318	106	428	1,4-alpha-glucan branching enzyme GlgB OS=Thermosynechococcus vestitus (strain IAM M-273 / NIES-2133 / BP-1) OX=197221 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000281_03186.