CAZyme Information: MGYG000000282_02238

Basic Information

• Species: TF01-11 sp003524945
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; TF01-11; TF01-11 sp003524945
• CAZyme ID: MGYG000000282_02238
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
281	MGYG000000282_20|CGC1	32324.41	4.7611

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000282	3383470	Isolate	China	Asia

• Gene Location: Start: 19623; End: 20468 Strand: -

Full Sequence      

MQKPVNKNASKEAAELLRYLEKTAGHGIITGQHTQTNPMEEIFYIKEVTGKTPKLRGFEL
LAYSPNINEKDAGEACLTEVYENRDTLKTAMKWAKESDGILTFSFHWFSPLGGRDKSFYA
EHTDFDPEKVLEEGSPERKAFYHDMAVIAGYLKEFCDEGIPILWRPFHESDGTWFWWGSK
GPEVARELYLLMYDYYVNEWHLDNLLWVWNCRLPEGYPGDAYVDVVSVDIYLPEYKPTDY
ADAYGELIKATSSDKVVALAEVGYMPDVDCLRSHIHHGHIT

Enzyme Prediction     

No EC number prediction in MGYG000000282_02238.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	5	272	2.3e-80	0.858085808580858

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	5.62e-46	5	269	1	267	Glycosyl hydrolase family 26.
COG4124	ManB2	1.21e-17	159	264	179	297	Beta-mannanase [Carbohydrate transport and metabolism].
COG2993	CcoO	0.003	175	263	97	163	Cbb3-type cytochrome oxidase, cytochrome c subunit [Energy production and conversion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM01251.1	1.36e-136	9	272	13	294
CBK82137.1	3.58e-134	1	274	1	275
AEB13973.1	5.07e-119	1	275	1	274
AZK45707.1	2.64e-114	4	273	6	272
AOZ93051.1	3.16e-111	4	271	9	276

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	1.88e-51	4	267	6	263	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	1.17e-47	6	274	147	406	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	1.66e-40	4	269	34	307	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6Q75_A	1.43e-34	4	266	23	282	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
6HF2_A	5.60e-32	9	269	50	299	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	1.73e-49	6	277	176	438	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	1.80e-44	3	272	27	307	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P49425	6.60e-44	9	274	151	419	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	9.88e-37	5	269	29	287	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55298	5.26e-34	5	268	157	412	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000091	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000282_02238.