CAZyme Information: MGYG000000284_00098

Basic Information

• Species: Parabacteroides sp900540715
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900540715
• CAZyme ID: MGYG000000284_00098
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
646	MGYG000000284_1|CGC5	72595.9	5.482

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000284	5935659	MAG	Sweden	Europe

• Gene Location: Start: 145509; End: 147449 Strand: -

Full Sequence      

MKMLNFNYLILWSLCACSSALHAQDATIRLETTPTDDLSFCVFYKGKEVIRKSPLGMTID
NRAIGKEVRIKSVTPGEQTNGERLCTYTIERPEGDIYYIDTREYADGIALRYRIPASTNI
CIYGEATSFTFPSRTKTWYASGPFQYGWLQEYQDRFTDDIEGEILAPPATFLTPDGVYAA
ITEANLFNYHGAVLLGTEPNQVRFGYVENKGHLETGVITGLPPSKYWHEAVRNVPWIVSP
KEGVNEVITPWRVLMLAENLNGLVNNKILAKVSDKPDKNLFPDGSETDWIKPGRATFTWL
VEGKDRLSIANHKKYVDGCAELGIEAVVVDDGWELWQQTEKNANGRTKWEMLKELVDYAG
ERNVNIWVWRSSSPRSGNKTDIGLVDPKERADFMRKCSEIGVKGLKIDFFHTENLFTVNL
MENILKDAAKEKLMVIFHGVNKPTGDSYTYPNLLAKEAVRGLETVGGENSWAPGPPWPYH
NTVLPFTRWLVGPADYTSLNFRAFCPPSITFAHQLSSIYMLTSPMLIFAADMEDMLSSPG
RSFIESVPVVWDETIVLPESEIGKLAALARRKGDVWYLTVLNGEEAGVFETNLDFLPKGK
YKMEIATDTPGNRKLIEIKESKICSGQKMKEQLMSGGGFVARISAI

Enzyme Prediction     

No EC number prediction in MGYG000000284_00098.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	17	643	1.6e-128	0.9793977812995246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	4.73e-55	287	548	2	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	8.58e-36	27	274	7	234	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	6.27e-27	551	644	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.
COG1082	YcjR	0.001	292	438	66	201	Sugar phosphate isomerase/epimerase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ47055.1	0.0	9	642	7	634
QLK84473.1	0.0	9	642	7	634
QRM72238.1	0.0	9	642	7	634
QTO25646.1	0.0	9	642	7	634
QCQ49590.1	0.0	9	642	7	634

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A24_A	6.82e-50	23	643	6	640	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5E1Q_A	7.36e-49	23	643	20	654	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
5HQ4_A	2.75e-43	19	646	1	661	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQC_A	2.75e-43	19	646	1	661	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	6.87e-43	19	646	1	661	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	1.03e-49	1	643	1	661	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	6.61e-44	19	641	41	618	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1
G8JZS4	5.72e-26	249	646	286	726	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000657	0.449689	0.548960	0.000278	0.000217	0.000190

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000284_00098.