CAZyme Information: MGYG000000284_00770

Basic Information

• Species: Parabacteroides sp900540715
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900540715
• CAZyme ID: MGYG000000284_00770
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493	MGYG000000284_7|CGC1	55435.85	6.6388

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000284	5935659	MAG	Sweden	Europe

• Gene Location: Start: 70256; End: 71737 Strand: +

Full Sequence      

MNRYKFFILCLSLICEVSLSAKDYYATDFGVKADGKTLNTNSIQKGIDFVNEQGGGRLIF
TAGNYQTGTIYLKSNVTLHLEEGATLQGSTNPWDYEKDPYIRWMSMIFAVKQQNIGITGK
GTINGRGFQTANNMVDYIRRGIYEDPLKLGRPNETNRPQNIYFRECENVTIKDITLRDPA
SWNQTYDQCKNLYVDGIHVDSKSYWNNDGIDVVDCDGVVLKNSFLDAADDALCFKSHDAN
SMCQNVVVENCVGRSSASGLKFGTVSRGGFRNFKVKNIKIYDTYRSAITFAAVDGALIEN
IEVDGVRSIHTGNVIYLRIGDRWSAGKKPVMKNIKIKNVYAEIPMDKPDAGYNYEGPIED
LPRNISPASIIGLPEYKIQNVTLQNIKIVSPGGGNPYYAYRGLTPAELDSIPEMETSYPE
FSQFKELPAWGFYIRHAEGITFDNVTFMALKKDYRPAVVMDDAGKVTFKDVRFVEPESEG
KEQIFPYKSKVIK

Enzyme Prediction     

No EC number prediction in MGYG000000284_00770.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	51	394	5.6e-57	0.9261538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	1.95e-49	26	474	85	516	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	1.14e-08	64	283	14	205	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02793	PLN02793	1.52e-06	20	347	49	338	Probable polygalacturonase
PLN03003	PLN03003	3.46e-06	1	302	1	292	Probable polygalacturonase At3g15720
PLN02218	PLN02218	2.18e-05	27	347	71	353	polygalacturonase ADPG

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT49882.1	0.0	1	493	1	493
BCG53462.1	1.65e-281	1	489	1	491
AHF16111.1	3.34e-266	3	489	2	489
QGA27491.1	9.05e-257	8	492	4	489
SCM56503.1	9.74e-257	1	492	1	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MXN_A	4.92e-41	22	252	20	236	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]
5OLP_A	6.88e-28	22	390	43	427	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
3JUR_A	3.19e-24	11	341	15	383	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
2UVE_A	4.39e-20	28	234	161	407	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15922	3.18e-20	27	234	155	400	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
A1DLC1	3.15e-06	55	299	76	305	Probable exopolygalacturonase X OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pgaX PE=3 SV=2
B0YDE8	3.15e-06	39	299	62	305	Probable exopolygalacturonase X OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pgaX PE=3 SV=2
Q4WCZ8	3.15e-06	39	299	62	305	Probable exopolygalacturonase X OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pgaX PE=3 SV=2
Q5ASG9	9.70e-06	55	397	76	417	Exopolygalacturonase X-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pgaX-1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001140	0.989972	0.008188	0.000220	0.000217	0.000219

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000284_00770.