CAZyme Information: MGYG000000284_01723

Basic Information

• Species: Parabacteroides sp900540715
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900540715
• CAZyme ID: MGYG000000284_01723
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
267		31111.41	6.0417

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000284	5935659	MAG	Sweden	Europe

• Gene Location: Start: 20265; End: 21068 Strand: -

Full Sequence      

MDRSKIEKIIFYSNILRKEMQVCVYLPKNYETSPPLPVLYFLHGRSGNENIMFEVDIQPK
ADLLIHNRNIEPLIIVCPRIENSRGINSSFNSQDIPDSIYNERIINLGMYEDYFIHEIIP
FIDNTFNTIRDRKSRFVGGASAGGYAALHNAFRHQDLFSKVGGHMPSLELTLEKEDMPYF
QDMDTWEKYDPISIARNNKIILDLEVYLDAGDKDEGEFYKGCSILQDILKKRAINSQNHV
FPGHHSIEYIKSNIEKYLEFYGKRTKE

Enzyme Prediction     

No EC number prediction in MGYG000000284_01723.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	13	260	1.3e-44	0.973568281938326

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	6.06e-20	3	245	65	279	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	2.26e-19	13	249	1	234	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2819	YbbA	5.20e-05	10	168	13	172	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CUS05080.2	5.52e-18	5	261	108	334
QIA08067.1	1.21e-17	5	259	42	274
QNL47921.1	2.32e-17	6	254	44	269
QQT64553.1	4.35e-17	5	178	39	207
QQT47644.1	4.35e-17	5	178	39	207

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7B5V_A	9.14e-16	5	243	138	365	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
5VOL_A	9.38e-13	3	260	9	267	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
6MOT_A	3.32e-11	11	243	122	338	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6MOU_A	3.54e-11	11	243	143	359	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393],6MOU_B Chain B, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6JZL_A	2.27e-08	13	263	23	275	S-formylglutathionehydrolase homolog from a psychrophilic bacterium of Shewanella frigidimarina [Shewanella frigidimarina],6JZL_B S-formylglutathione hydrolase homolog from a psychrophilic bacterium of Shewanella frigidimarina [Shewanella frigidimarina]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000284_01723.