CAZyme Information: MGYG000000284_03295

Basic Information

• Species: Parabacteroides sp900540715
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900540715
• CAZyme ID: MGYG000000284_03295
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
670	MGYG000000284_58|CGC1	76758.65	4.8153

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000284	5935659	MAG	Sweden	Europe

• Gene Location: Start: 28008; End: 30020 Strand: -

Full Sequence      

MNNIINYFSVYSALLLSSCNIGLKNNVFPEEIKNDRDDFYNLINIKNVPQTETDRDCFVF
ADLGSWTAYALPENEENRLAGSFIGPYMMTGRGWIARSLAEPIIRVDGEKFDLARNIQTS
KYYPGKLVQEFRNEQLSFVTELCFLSARTALIRSRVENTGGREVSVSLQWRGGVYEDSAT
LSIEEKGIRIANNREQTFTYASFLTAEDVRLVGTDSLLVVEKEELRLSPGGSFETASTQT
FAFDRGALDKELEQLKGLEVDLVFSENEKRWNTYLSSLFDNDSPFMKENKYRHVVVKALM
TLIANWRTPSGDILHDGTYPSYNGFFGIWSWDSWKHAAANALYNPEEAKNEIRCLFDYQA
ENGMIPDFVSRNKERINWRDTKPPLAAWAVKCIYDVTGDKAFVAEMFDKLYKYHQWWYTD
RDHDKNGICEYGSTDGTLVAACWESGMDNGVRFDDAVMLKNEPEKAWSMNQENICLNSFL
YAEKNFLAEMAEILDKKDLALQLNKEAEALKNHIQTKMFDEETGFFYDTRLGTGEFIKVM
GAECWLPLWAGVATPQQARKVLEKMLDPEKFNSKVPLGTLDISHPRLRPTRGYWRGPVWI
DQVYFGVTGLRKYGFNKEADQLISQYIDNAQGLLTDGPIHENYNPLTGETLNCPNFSWSS
AMTIRMLLNK

Enzyme Prediction     

No EC number prediction in MGYG000000284_03295.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	9	666	8.1e-143	0.9736842105263158

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	2.48e-146	1	669	1	781	alpha-glucosidase; Provisional
COG3408	GDB1	8.50e-19	326	668	282	604	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	1.04e-16	381	667	178	505	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
PLN02567	PLN02567	4.78e-10	383	667	205	541	alpha,alpha-trehalase
COG1626	TreA	1.56e-09	474	667	354	549	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU00825.1	6.89e-308	13	670	15	669
QQA30345.1	6.89e-308	13	670	15	669
QUT61859.1	6.89e-308	13	670	15	669
BBK86094.1	7.97e-307	13	670	15	669
BBD44200.1	2.85e-298	24	669	21	671

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	5.96e-94	37	661	3	747	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	3.17e-93	37	661	3	747	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	4.42e-93	37	661	3	747	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	1.35e-89	37	661	4	748	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	1.34e-43	439	661	41	296	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	5.34e-93	37	661	26	770	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	8.26e-24	329	667	98	485	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	1.97e-23	329	667	98	485	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
K5BDL0	4.36e-13	328	667	39	445	Glucosylglycerate hydrolase OS=Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849) OX=1122247 GN=ggh PE=1 SV=1
P94250	3.32e-11	323	614	62	319	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000311	0.025835	0.973823	0.000014	0.000020	0.000020

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000284_03295.