CAZyme Information: MGYG000000284_03983

Basic Information

• Species: Parabacteroides sp900540715
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900540715
• CAZyme ID: MGYG000000284_03983
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
156		17583.5	7.2399

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000284	5935659	MAG	Sweden	Europe

• Gene Location: Start: 25544; End: 26014 Strand: +

Full Sequence      

MTAQQIRFVKDSLQAAVSAGAVFHMNPSVILAQAAFESGWGTSRLATESNNFFGLTAYGC
SNEYWHGGKTEVRTDSYSLHFRRYDTRANSFLDFARLIRNSYRVAWQCSNDPEAYAREIA
YSPYISELNGDDRESYRRSLVQIERTVQAIVALTGG

Enzyme Prediction     

No EC number prediction in MGYG000000284_03983.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	14	145	5.3e-25	0.9453125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	7.73e-22	1	148	39	183	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
pfam01832	Glucosaminidase	3.29e-20	14	94	2	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK12713	flgJ	1.17e-15	6	152	182	331	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK05684	flgJ	1.27e-14	27	119	174	275	flagellar assembly peptidoglycan hydrolase FlgJ.
NF038016	sporang_Gsm	2.40e-14	1	124	158	289	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50705.1	8.06e-81	1	155	1	155
QUR50514.1	1.49e-50	8	150	5	147
QUT19172.1	2.11e-50	8	150	5	147
QUT54392.1	2.24e-50	8	150	5	147
QKH97660.1	2.99e-50	8	150	5	147

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	6.05e-08	11	133	11	138	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	6.84e-08	11	133	12	139	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
4Q2W_A	1.00e-06	23	58	182	217	CrystalStructure of pneumococcal peptidoglycan hydrolase LytB [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9X9J3	4.09e-08	8	150	163	308	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9I4P4	2.51e-06	1	153	235	391	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
P59205	6.96e-06	23	58	550	585	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=lytB PE=1 SV=1
P59206	7.03e-06	23	58	594	629	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=lytB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998227	0.001753	0.000021	0.000005	0.000002	0.000004

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000284_03983.