CAZyme Information: MGYG000000284_04297

Basic Information

• Species: Parabacteroides sp900540715
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900540715
• CAZyme ID: MGYG000000284_04297
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	MGYG000000284_103|CGC1	48382.55	6.7828

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000284	5935659	MAG	Sweden	Europe

• Gene Location: Start: 2185; End: 3426 Strand: -

Full Sequence      

MVQPLGLRKYEIVAGKGFYLNGEKYPMYGVTRHQDWWGLGSALKNENHDFDLATIMDVGA
TTVRFAHYQQSDYLYSRCDSLGLIIWAEIPFVNRVTGQEAENCRNQLREMIRQSFNHPSI
YVWGLHNEVYQPHQYTKELTQSLHDLAKTEDPDRYTVSVNGYGHMEHPVNLVADIQGMNR
YFGWYEKKIQDIKPWVEGLEKEYPHQKLMLTEYGADANLNHQTEYLGDALNWTKEFYPET
FATKTHEYQWSVIAAHPYIIASYLWNTFDFCAPMWVRGGVPARNMKGLVTFDRKIKKDSY
FWYKANWSKDPVLFLTQRRNWDREKKETSVTVYSNIGTPKVYLNGKELGGIREGYTRVHY
IIDNVTLDMGKNIVKTVVVKDGKTYEDEIEWMYSGEKKRDSDQSVNKEEHAGF

Enzyme Prediction     

No EC number prediction in MGYG000000284_04297.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	4.50e-21	3	311	271	596	beta-D-glucuronidase; Provisional
COG3250	LacZ	3.97e-18	6	216	282	478	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	6.95e-17	13	270	3	265	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	3.47e-08	3	128	313	449	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48948.1	5.99e-271	1	413	292	704
QCQ30844.1	8.21e-271	1	413	292	704
QTO26658.1	3.33e-270	1	413	292	704
QCQ44145.1	3.33e-270	1	413	292	704
QCQ48666.1	3.33e-270	1	413	292	704

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FN9_A	4.74e-266	1	412	273	684	Crystalstructure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_B Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_C Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_D Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6MVH_A	3.84e-82	6	365	280	636	Crystalstructure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_B Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_C Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_D Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis]
3CMG_A	4.66e-81	1	393	259	655	Crystalstructure of putative beta-galactosidase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5Z1A_A	6.12e-81	1	393	278	674	Thecrystal structure of Bacteroides fragilis beta-glucuronidase in complex with uronic isofagomine [Bacteroides fragilis NCTC 9343]
6MVG_A	5.48e-80	6	349	280	620	Crystalstructure of FMN-binding beta-glucuronidase from Ruminococcus gnavus [[Ruminococcus] gnavus],6MVG_B Crystal structure of FMN-binding beta-glucuronidase from Ruminococcus gnavus [[Ruminococcus] gnavus],6MVG_C Crystal structure of FMN-binding beta-glucuronidase from Ruminococcus gnavus [[Ruminococcus] gnavus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	1.20e-48	5	393	305	720	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
T2KM09	6.15e-22	6	354	303	670	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
A7LXS9	2.42e-21	4	383	306	727	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
P26257	7.57e-18	17	213	275	463	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
P77989	3.29e-17	6	213	263	454	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000284_04297.