CAZyme Information: MGYG000000284_04340

Basic Information

• Species: Parabacteroides sp900540715
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900540715
• CAZyme ID: MGYG000000284_04340
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1054		120663.62	6.1072

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000284	5935659	MAG	Sweden	Europe

• Gene Location: Start: 10135; End: 13299 Strand: -

Full Sequence      

MKLTNFVSIALLFLSLDIPTQAQDVESLSGTWQFRLDPEDKGLKENWQGTSFTDHITLPG
TTDEAGYGEKTSGSDFGILTRAWKYYGPAWYSKEIEIPSEWNGKYIRMELERVLWESRLF
LDGKEVSVQDALSTPHWHDLGYLTPGKHRLTIRIDNDMIYNIGDKGHVYSEYTQSIWNGA
VGRIRLVASEPIRFSNPQVFTRTTNGPCTLQVRDTLINESSRKVPARITWQLTDREDGSV
VYTRTIEQLLQKGRNILDFEATMPENIRFWNDITPNLYVLKVTLEDKKKQFDSREIEFGF
REVSHSNSKILVNGKPVFLRGNLDCVHFPLTGYPSCKVEDWEKIFRIYKDYGLNHVRFHS
WCPPEAAFIAADRLGIYIQAETIWIDWWMSSEQKDRPEMNTKGYPQGLGKNPSADRYVQQ
ELTRMIDAYGNHPSFVMQCIGNELGNSDFEVMESWMKPLKEKDSRRLYSVSTARKIMPVD
QYMATHYINGLGSARGLKGGASTSWDFEDVYSKSNIPVLSHEIGQWPVYPRWSEIKKYKG
VLKARNFEEFREQARKNKIEEQNEEFVAASGALNQIMYKYEIESFLRTPSCAGIQLLSMQ
DYQGQGEALVGWLDVFYDSKGITTPEQFRCHHDSTVPLLRIPKYVWTNNEPFTADLQLAH
YGSTCLSDGLYWKIKDAEGNLVASGRTANRTFPAGSSDIAGKISCDLSAVTTAQKLVVEV
GLQNDAIANTWNIWVFPANEKVETGTVYVTDRMDADCLKRLEKGEKVLLQAAALGTEETC
DKISFYPLYWSLTFFPGQGKNTIGMIVRDKHPLFARFPTESHSDWQWQSIYKDARAFYIN
DYPEEYKPIAQPVDDFHRNNKLASIFELKVGKGKLLVCGFDLKDESNPVARQLKSSILHY
MNSTDFNPAYEREITSLQKMLTYVEPLKSTVTGEFGNALLYIDCADKDKTFAKKKTTYQV
SPDWQGKEMELTIQCPPGIIGSLYVCFADKDKKGRTGHLVFEGREYESDKQDQEESWVKL
HIMREDSNDGILRFKAKVKNGPDLVISKVAIVEE

Enzyme Prediction     

No EC number prediction in MGYG000000284_04340.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	21	696	6.5e-67	0.6875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.65e-28	17	537	4	526	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	7.74e-19	13	467	21	471	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	4.82e-18	18	466	5	443	beta-D-glucuronidase; Provisional
pfam02837	Glyco_hydro_2_N	5.08e-12	25	180	1	157	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
pfam02836	Glyco_hydro_2_C	1.08e-07	307	459	5	152	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQD16168.1	0.0	5	1054	4	1075
QQT56131.1	0.0	1	1054	1	1074
QOD61956.1	0.0	12	1054	10	1066
QTE22603.1	0.0	9	1054	7	1066
AOM80476.1	0.0	22	1053	19	1049

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	4.36e-21	27	475	40	471	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	4.36e-21	27	475	41	472	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6ECA_A	1.04e-15	26	487	41	495	Lactobacillusrhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus],6ECA_B Lactobacillus rhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus]
7SF2_A	5.03e-15	21	441	35	425	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6LEM_B	8.21e-14	18	443	3	411	ChainB, Beta-D-glucuronidase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	2.39e-20	27	475	41	472	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
Q6D736	2.54e-14	22	457	57	487	Beta-galactosidase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=lacZ PE=3 SV=1
A8AKB8	3.31e-14	27	457	54	477	Beta-galactosidase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=lacZ PE=3 SV=1
P05804	4.51e-13	18	443	5	413	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
B1LIM9	1.14e-12	22	457	49	477	Beta-galactosidase OS=Escherichia coli (strain SMS-3-5 / SECEC) OX=439855 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000225	0.999116	0.000171	0.000168	0.000152	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000284_04340.