CAZyme Information: MGYG000000284_04524

Basic Information

• Species: Parabacteroides sp900540715
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900540715
• CAZyme ID: MGYG000000284_04524
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
779	MGYG000000284_122|CGC1	88723.06	5.1921

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000284	5935659	MAG	Sweden	Europe

• Gene Location: Start: 271; End: 2610 Strand: -

Full Sequence      

MNYSMKIVTILMALLICVLTGCKNQSGNEGTFEIGDKTFLLNGKPFVIKAAEIHYTRIPV
EYWEHRIQMCKALGMNTICIYAFWNIHEQKPGEFDFTGQNDIAAFCRLAQKYDMYIMLRP
GPYVCSEWEMGGLPWWLLKKEDIQLRTNDPYFIERTRIYMNEIGKQVADLQITRGGNIIM
VQVENEYGSYATDKEYIAKNRDILREAGFTDVPLFQCDWSSNFLNNALDDLVWTVNFGTG
ANIDEQFKKLKEVRPNTPLMCSEFWSGWFDHWGRKHETRDAETMIAGLKDMLDRNISFSL
YMTHGGTTFGHWGGANSPAYSAMCSSYDYDAPISEAGWTTPKYYKLREFMAGYMEPGEVM
ADIPEAFPVIEIPEFELKETALLFDNLPEPKTSHDIKPMEQFDQGWGSILYRTTLPAVKA
GTTLLIDEVHDWAQVFIDGKLIGRLDRRRGENTIKLPAAAAGSQLDILIEAMGRVNFDKA
IHDRKGITKKVALITESSSDELKDWQVYNLPVDYSFVKDKKFTTGKKAEGPAYYRATFNL
ETPGDVFLDMQTWGKGMVWVNGKAMGRFWEIGPQQTLFMPGCWLKKGENEIIVLDLKGPE
KATIKGLNQPILDLLRAEAPLTNRKEGQNLDLKNEKPVGQGSLKAGNGWQEVRFDAPVEA
RHFCLEALNAQDGGNTAAIAEFYLLDENGNPLGRQHWQIGYADSEETYGGNFTADKIYDL
QESTYWSTARGAKYPHQVVIDLRETVTVSGFRYLPRAEEGYPGMIKDYKAYTRMTPFKY

Enzyme Prediction     

No EC number prediction in MGYG000000284_04524.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	39	350	3.9e-117	0.990228013029316

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	1.58e-165	38	348	1	313	Glycosyl hydrolases family 35.
PLN03059	PLN03059	1.54e-49	9	604	7	721	beta-galactosidase; Provisional
COG1874	GanA	1.03e-39	37	620	6	614	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam00754	F5_F8_type_C	1.86e-06	702	774	2	72	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	4.88e-04	693	769	8	79	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50204.1	0.0	15	777	16	778
QRO23434.1	0.0	13	778	14	781
QUT77306.1	0.0	10	779	5	776
QIU94062.1	0.0	6	779	4	778
BCA48215.1	0.0	32	779	29	778

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EON_A	0.0	11	778	8	778	GalactanaseBT0290 [Bacteroides thetaiotaomicron VPI-5482]
3D3A_A	2.90e-312	28	628	4	605	Crystalstructure of a beta-galactosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4MAD_A	8.72e-140	36	596	21	578	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
3WF3_A	2.54e-122	20	612	23	645	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]
3WEZ_A	5.02e-122	20	612	23	645	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48982	1.85e-141	31	579	29	573	Beta-galactosidase OS=Xanthomonas manihotis OX=43353 GN=bga PE=1 SV=1
Q9TRY9	2.50e-123	10	612	13	645	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3
P16278	1.25e-122	2	612	3	644	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2
Q5R7P4	3.76e-121	2	612	3	644	Beta-galactosidase OS=Pongo abelii OX=9601 GN=GLB1 PE=2 SV=1
Q60HF6	1.29e-119	2	612	3	644	Beta-galactosidase OS=Macaca fascicularis OX=9541 GN=GLB1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000058	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000284_04524.