CAZyme Information: MGYG000000284_04603

Basic Information

• Species: Parabacteroides sp900540715
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900540715
• CAZyme ID: MGYG000000284_04603
• CAZy Family: GH97
• CAZyme Description: Glucan 1,4-alpha-glucosidase SusB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
736		83674.54	5.6731

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000284	5935659	MAG	Sweden	Europe

• Gene Location: Start: 4666; End: 6876 Strand: +

Full Sequence      

MKRSILFLAALFGCCAVSYAQQLLSPDGNLKMTFKLDEKGAPVYDLSYKQKEVIKPSKLG
LELKKEDADAAVDFEFKQRKDVAALDKKTNLYDGFKITDTRTAAFDETWQPVWGEEKEIR
NQYNELAVTLDQPANDRSIVIRFRLFNDGLGFRYEFPQQKELNYFVIKEEKSQFAMAGDH
KAFWLPGDYDTQEYSTMTSRLSEIRGLMKEAVTPNSSQTPFSQTGVQTPLMMKSEDGLYI
NLHEAALVDYSCMHLNLDDKNMVFESWLTPDAKGDKGYLQTPCQSPWRTVIVSDDARDIL
ASRITLNLNEPCKLEDVSWIKPVKYIGIWWDMITNKGTWAYTDELSSVKLGETDYTKVKP
NGRHSANTANVKRYIDFAAANGFDAVLVEGWNEGWEDWFGKSKDYVFDFVTPYPDFDVQE
IHRYAASKGIKMMMHHETSASVRNYERHMDKAYQFMVDNGYNSVKSGYVGDIIPRGEHHY
GQWMCNHYLYAVKKAADYKIMVNAHEATRPTGLCRTYPNLIGNESARGTEYESFGGNNVD
HTTILPFTRLIGGPMDYTPGIFETHCSAMNPSNTSQVRSTLARQLALYVTMYSPLQMAAD
IPEHYEQYADAFQFIKDVALDWDKSLYLEAEPGDYITIARKAKGTGDWFVGCTADEDGHD
SRLSFDFLEPGKKYIATVYADAKDADWKNNPQAYTIKKGLLTNKSKLNLKAVCGGGYAIS
IFEVKDLKDIKGLKNL

Enzyme Prediction     

EC	3.2.1.3	3.2.1.20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	13	721	1.9e-253	0.9889064976228209

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	7.19e-148	316	619	1	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	5.39e-100	25	311	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	8.72e-42	622	721	1	96	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT41578.1	0.0	2	736	3	738
QQA08181.1	0.0	2	736	3	738
BCA48258.1	0.0	2	736	3	738
ALJ44109.1	0.0	2	736	3	738
AAC44671.1	0.0	2	736	3	738

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2D73_A	0.0	21	736	23	738	CrystalStructure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2D73_B Crystal Structure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2ZQ0_A Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron],2ZQ0_B Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron]
2JKA_A	0.0	22	736	13	727	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]
3WFA_A	0.0	21	736	3	718	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
5HQC_A	8.69e-176	25	719	5	656	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQ4_A	1.23e-175	25	719	5	656	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G8JZS4	0.0	2	736	3	738	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
Q8A6L0	1.76e-62	15	721	13	661	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	3.26e-24	144	663	137	572	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001785	0.722312	0.274638	0.000389	0.000453	0.000384

TMHMM  Annotations     

start	end
5	24