CAZyme Information: MGYG000000286_00215

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; CAG-274
• CAZyme ID: MGYG000000286_00215
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	MGYG000000286_35|CGC1	39389.98	6.1378

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000286	1017072	MAG	Sweden	Europe

• Gene Location: Start: 3483; End: 4544 Strand: -

Full Sequence      

MAIFQINSSKNNNSHADIGAGGVPAEFVQYFNEASDLTGIPNWVLAGIAKQESNFNPNDS
YGGAYGIMQQQRYDFDGSDIYKYYLDLGLGDIYKQLGYSFSSVDEIWNVFLKDVRLQIIT
GAYETRHYANYVLYRKKLVPTLEYNSTENLKVINWNADENDSNFSEILRRIFACYNGGPG
YGMSVNLDTAQNNYPNNVFKYAMEFRSKGLVNSGGIKGDNETIEKAIEAGMKWVGKSPYV
WGGGRTEADVIAGRFDCSSLVHYCYASAGIQLGDRSSVTTWSLLTLGKSVPKEQMKRGDL
IFFDTAGRNGHVGIYLGNGKFLNDSSTKGVSIGDLNSPYWSRYFNGNVRRIIE

Enzyme Prediction     

No EC number prediction in MGYG000000286_00215.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00877	NLPC_P60	8.97e-33	238	350	3	105	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
COG0791	Spr	1.58e-27	219	346	71	195	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].
NF033742	NlpC_p60_RipB	6.57e-18	223	353	77	205	NlpC/P60 family peptidoglycan endopeptidase RipB.
PRK13914	PRK13914	3.14e-17	137	346	303	477	invasion associated endopeptidase.
NF033741	NlpC_p60_RipA	5.17e-16	224	322	329	428	NlpC/P60 family peptidoglycan endopeptidase RipA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAX89037.1	4.10e-265	1	353	19	371
QDB01094.1	5.82e-265	1	353	19	371
AWS25316.1	1.83e-198	8	353	50	395
AMN32101.1	1.83e-198	8	353	50	395
QUD74418.1	6.82e-198	8	353	39	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2K1G_A	1.26e-14	243	353	24	125	SolutionNMR structure of lipoprotein spr from Escherichia coli K12. Northeast Structural Genomics target ER541-37-162 [Escherichia coli K-12]
3PBC_A	1.83e-14	221	322	83	185	ChainA, Invasion Protein [Mycobacterium tuberculosis]
3NE0_A	1.83e-14	221	322	83	185	Structureand functional regulation of RipA, a mycobacterial enzyme essential for daughter cell separation [Mycobacterium tuberculosis H37Rv]
4Q4T_A	1.38e-13	221	322	341	443	Structureof the Resuscitation Promoting Factor Interacting protein RipA mutated at E444 [Mycobacterium tuberculosis H37Rv]
3S0Q_A	3.05e-13	221	322	84	186	ChainA, INVASION PROTEIN [Mycobacterium tuberculosis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q65NQ9	6.63e-45	213	353	313	452	Peptidoglycan DL-endopeptidase CwlO OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=cwlO PE=3 SV=1
P40767	7.27e-40	223	353	343	473	Peptidoglycan DL-endopeptidase CwlO OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlO PE=1 SV=2
P76190	9.24e-14	223	352	137	265	Murein DD-endopeptidase MepH OS=Escherichia coli (strain K12) OX=83333 GN=mepH PE=1 SV=1
P0AFV4	2.18e-13	243	353	85	186	Murein DD-endopeptidase MepS/Murein LD-carboxypeptidase OS=Escherichia coli (strain K12) OX=83333 GN=mepS PE=1 SV=1
P0AFV6	2.18e-13	243	353	85	186	Murein DD-endopeptidase MepS/Murein LD-carboxypeptidase OS=Escherichia coli O157:H7 OX=83334 GN=mepS PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000286_00215.