CAZyme Information: MGYG000000287_01259

Basic Information

• Species: Robinsoniella sp900539655
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900539655
• CAZyme ID: MGYG000000287_01259
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1129	MGYG000000287_11|CGC2	124114.19	4.1141

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000287	7249439	MAG	Sweden	Europe

• Gene Location: Start: 61988; End: 65377 Strand: -

Full Sequence      

MAGKRKGKKLCALVLTAAMAGSVLPASQAMEVLAKEPERKTYEPSWESVEQVTTAPEWFQ
DAKFGIYFHWGAFTTPERVDEWYGQHMYNGSGAAHDYHVNTYGWPSEWPYHNFILGAEDK
AGNWVQFAPKLTADYAQGNEGGKFDPNAWAKLFKDAGAKFAGPVMEHHDGYSMWDSDVNP
WNSVDLGPKLDLAELFVDAIRGEDLKVLSAMHHAYNVTGGFYDSAWDEKPWETPVEGMTA
EDMKKLYGQFSTVEERDEYWLAKLKEVIDKYDPDIIWQDFQVGLLSEESRLEFLSYFYNK
DVVENGDGVVATYKYNHEVNDGFTEASAVPDYERGGPGGMRDFYWLTDDSVSQGTWSYTD
GMQYYSAKTLINALADKISKNGNLLLNISPRADGSIPQGQQDVLLEIGDWLERYGEAVYS
TRAWSVYGEGPTVMGGGVWQTPVSGTSNDIRFTRSKDNTTLYAIALGNPDNKILDIKTLK
NNVLDVSAVLGVYMADGTETPLAYTQDEAGFHITLPETQDSIDANGRAVKIVFNETIPDI
QGVTLWSENDFKGTAASLVPGVYNAADLQAAGVTTDTTSSIQIPEGYTAYIYDEGEPAGA
YGVLDQDASDLGAWNDKIAAVKIIKNTEIPESIEPEEGKAYQLQLRNNPDFVLAYATDAE
NNGNVQIASKDDTAENQKWIFTPVGDSYKISPAANTDLCIDIDGGNYQNGSNLLLWEYGD
GADNRHWKLEPTGGGYYSIHSKGNSGFCIDEAAVSPEDGGNVQLWNYEYGDRQQWILKEV
TQETEGVDTTSLELAIAMAEKMAAEQAEKGSYTKESWAAVQKSLDAAKALLESDLTQEQA
DEAFISLITACNLLENSTQKVGLEAAIKGTEAILDDTQNLEKYTVESVEAVKTALAEARL
VYENIAADQGTINSATTNLLTAVTCLLAEQDSTRLDILIQTAEKLIKNEEQYTPSSVQRL
KEALDRAKAVRDNTQASEQEISDAYNLLAESMTGLVRKANKTELRNALDKAAEILAKPEK
YVESTISGLADVKAEAQAVYEDGEADADTTGEELKKLIAEILKARLLGDVDLNGIVDTQD
AAELLEYNAELKELSREQAEAGDVNRDAATDSSDASAILQYAAEKISEF

Enzyme Prediction     

No EC number prediction in MGYG000000287_01259.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	32	419	1.3e-90	0.9450867052023122
CBM13	640	784	4.5e-25	0.7127659574468085

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	5.30e-109	41	479	6	384	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	3.87e-101	40	416	4	333	Alpha-L-fucosidase.
COG3669	AfuC	3.91e-56	69	453	1	356	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam14200	RicinB_lectin_2	3.32e-20	676	765	2	89	Ricin-type beta-trefoil lectin domain-like.
cd00161	RICIN	1.60e-19	641	777	1	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUG81783.1	1.96e-188	41	736	36	656
AVV47052.1	3.64e-181	41	739	38	658
QCD59776.1	5.60e-180	14	623	17	602
AYC36835.1	4.36e-179	41	735	38	654
QEV22842.1	6.13e-179	14	735	17	654

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4NI3_A	7.33e-150	42	592	7	553	ChainA, Alpha-fucosidase GH29 [Fusarium graminearum],4NI3_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum],4PSP_A Chain A, Alpha-fucosidase GH29 [Fusarium graminearum],4PSP_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum],4PSR_A Chain A, Alpha-fucosidase GH29 [Fusarium graminearum],4PSR_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum]
7LJJ_A	3.31e-71	48	531	49	510	ChainA, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LK7_A Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]
7LNP_A	1.57e-70	48	531	49	510	ChainA, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_C Chain C, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_D Chain D, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_E Chain E, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]
1ODU_A	2.33e-47	42	479	8	401	CrystalStructure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8],1ODU_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8]
2ZWY_A	2.65e-47	42	479	8	401	alpha-L-fucosidase[Thermotoga maritima],2ZWY_B alpha-L-fucosidase [Thermotoga maritima],2ZWZ_A alpha-L-fucosidase complexed with inhibitor, Core1 [Thermotoga maritima],2ZWZ_B alpha-L-fucosidase complexed with inhibitor, Core1 [Thermotoga maritima],2ZX5_A alpha-L-fucosidase complexed with inhibitor, F10 [Thermotoga maritima],2ZX5_B alpha-L-fucosidase complexed with inhibitor, F10 [Thermotoga maritima],2ZX6_A alpha-L-fucosidase complexed with inhibitor, F10-1C [Thermotoga maritima],2ZX6_B alpha-L-fucosidase complexed with inhibitor, F10-1C [Thermotoga maritima],2ZX7_A alpha-L-fucosidase complexed with inhibitor, F10-2C [Thermotoga maritima],2ZX7_B alpha-L-fucosidase complexed with inhibitor, F10-2C [Thermotoga maritima],2ZX8_A alpha-L-fucosidase complexed with inhibitor, F10-2C-O [Thermotoga maritima],2ZX8_B alpha-L-fucosidase complexed with inhibitor, F10-2C-O [Thermotoga maritima],2ZX9_A alpha-L-fucosidase complexed with inhibitor, B4 [Thermotoga maritima],2ZX9_B alpha-L-fucosidase complexed with inhibitor, B4 [Thermotoga maritima],2ZXA_A alpha-L-fucosidase complexed with inhibitor, FNJ-acetyl [Thermotoga maritima],2ZXA_B alpha-L-fucosidase complexed with inhibitor, FNJ-acetyl [Thermotoga maritima],2ZXB_A alpha-L-fucosidase complexed with inhibitor, ph-6FNJ [Thermotoga maritima],2ZXB_B alpha-L-fucosidase complexed with inhibitor, ph-6FNJ [Thermotoga maritima],2ZXD_A alpha-L-fucosidase complexed with inhibitor, iso-6FNJ [Thermotoga maritima],2ZXD_B alpha-L-fucosidase complexed with inhibitor, iso-6FNJ [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P17164	1.42e-42	42	517	33	442	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1
Q99LJ1	2.12e-42	31	522	14	437	Tissue alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca1 PE=1 SV=1
P48300	1.23e-41	40	517	35	445	Tissue alpha-L-fucosidase OS=Canis lupus familiaris OX=9615 GN=FUCA1 PE=2 SV=1
P10901	1.54e-41	42	516	21	441	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
P04066	1.12e-39	29	521	25	450	Tissue alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA1 PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003128	0.994872	0.000728	0.000557	0.000354	0.000324

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000287_01259.