CAZyme Information: MGYG000000287_02503

Basic Information

• Species: Robinsoniella sp900539655
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900539655
• CAZyme ID: MGYG000000287_02503
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
664	MGYG000000287_34|CGC1	77161.53	4.9998

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000287	7249439	MAG	Sweden	Europe

• Gene Location: Start: 3181; End: 5175 Strand: -

Full Sequence      

MIKCEGNKIWRRFDKELLCVEPWGKNSLRVRATQRHEFLRDDHGALLEPAECESRIFKEN
GETVLVNGKIRCEITPTGKLRFKNDKGELLLEEYERIREEIQGRKEFNSALEIIPRTFEP
HPNTDNYRLMVRFEPNEGEKLYGCGQYQQPYLDVKGCTLELAHRNSQASIPFVLSNKGYG
MLWNNPAIGSVTFGKNVTEWAAHSTKQMDYWITAGDSPAEIEEAYADATGKVPMMPDYGM
GFWQCKLRYQTQDEIMEVAREYKRRGLPISVIVVDFFHWPNQGDWKFDLDYWPDPKKMVD
ELKEMGIELMVSIWPTVDAGSENYKEMEELGYLTRSEYGKRIGQLGDACIIDPTNPEARA
YVWDKIRRNYYDLGIKIFWLDEAEPEFTGYEYSHYRYFRGADMEVGNIYPREYARMAYEG
MEAAGQENIVNLLRCAWAGSQKYGTLVWSGDIDSSFRSMRNQLAAGLNMGLSGIPWWTTD
IGGFHGGNIEDDAFKECLIRWFEFGTFCPVFRLHGFREPFKEALGTTGGGKHISGAENEV
WSYGEEVLAICTKYMELRERMKPYITRIMKEAHEKGTPVMRPLFYDFPEDRICWETEDVY
MFGPDLLVAPILHENQRQRKVYLPAGRWRNIHDNREYQGGQEIDVIAPIDEIPVFARNGE
RIMI

Enzyme Prediction     

No EC number prediction in MGYG000000287_02503.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	210	660	2.4e-150	0.9929742388758782

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1501	YicI	0.0	127	659	141	667	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06591	GH31_xylosidase_XylS	3.12e-179	230	558	1	322	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.
pfam01055	Glyco_hydro_31	2.18e-152	214	659	4	439	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
PRK10658	PRK10658	1.20e-73	138	659	158	665	putative alpha-glucosidase; Provisional
cd06592	GH31_NET37	1.33e-71	234	628	1	364	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW80164.1	0.0	1	660	1	660
QIB57059.1	0.0	1	660	1	660
QBE96559.1	0.0	1	660	1	660
ASU29738.1	0.0	1	660	1	660
QQQ94515.1	0.0	1	660	1	660

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DRU_A	3.38e-103	133	655	141	704	Xylosidasefrom Aspergillus niger [Aspergillus niger],6DRU_B Xylosidase from Aspergillus niger [Aspergillus niger]
2XVG_A	2.59e-86	201	659	396	871	crystalstructure of alpha-xylosidase (GH31) from Cellvibrio japonicus [Cellvibrio japonicus],2XVK_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with 5-fluoro-alpha-D-xylopyranosyl fluoride [Cellvibrio japonicus],2XVL_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with Pentaerythritol propoxylate (5 4 PO OH) [Cellvibrio japonicus]
5JOU_A	2.54e-83	200	659	367	841	Bacteroidesovatus Xyloglucan PUL GH31 [Bacteroides ovatus],5JOV_A Bacteroides ovatus Xyloglucan PUL GH31 with bound 5FIdoF [Bacteroides ovatus]
7KMP_A	2.78e-82	195	659	394	862	ChainA, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306],7KNC_A Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306]
6JR6_A	2.39e-74	169	662	195	688	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q01336	2.26e-219	6	519	8	527	Uncharacterized family 31 glucosidase ORF2 (Fragment) OS=Pseudescherichia vulneris OX=566 PE=3 SV=1
Q9P999	4.94e-121	127	659	100	619	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
A2QTU5	2.86e-102	133	655	159	722	Alpha-xylosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axlA PE=1 SV=1
A7LXT0	1.37e-82	200	659	366	840	Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02646 PE=1 SV=1
Q9F234	7.79e-65	136	662	144	674	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000287_02503.