CAZyme Information: MGYG000000287_02901

Basic Information

• Species: Robinsoniella sp900539655
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900539655
• CAZyme ID: MGYG000000287_02901
• CAZy Family: GT2
• CAZyme Description: Cellulose synthase catalytic subunit [UDP-forming]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
627	MGYG000000287_43|CGC2	71921.79	8.6408

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000287	7249439	MAG	Sweden	Europe

• Gene Location: Start: 34374; End: 36257 Strand: -

Full Sequence      

MGFIYFLIAAGGSFLISNFVKRNRCSTKILVRWNFMITFIYIIWRVTVIPTASIWELCLG
VLLLAGELLGIAQFLLSQLLLSRKYRLKKKSLEDYNGHIPTVDIFICTYNEGEDLVETTV
LAALNLDYPRDKFNIYICDDGQRRYMKRLAARCGVNYMTRGSNEGAKAGNLNNALRHSTG
ELFAVLDADMICSKNFLKYTVGYFSDEDTAFVQTPQVYYNKDMYQRNLGREIPNEQDFFM
REIQEARAAVGAVLHVGTNAVFRRKSVMEIGMYPTNTITEDMAVGMLLQAAGYQSVFINE
VLVLGLTASTYTDLVIQRDRWCRGNIQTSREYHPLRMKGLSTWQKLAYLGGDIYWYTGFS
KMIFTFCPIWFLLTTKLAMQADLPGILTFFLPFFIGQMTSFYAMISNTRSLKWAHYYEIA
MAPHMCLSVLREFFSASLNFAVTPKEMRDDRSHFQAQVILPHMVIAAITMFSWLTGGIFL
HLGYIGLIPFLVNLVWSIYNFMGVIICIRVAYHIGNTPRSNYATVKSGHKITVETETESY
PGEVMGFIESGMYIHVQAPLYFTKVRIQMQYQELNVILDGTLKMSGNQGLFKYDWLNLNQ
KRAIVGIYVEHLQPSFNVEKKMHYLEA

Enzyme Prediction     

No EC number prediction in MGYG000000287_02901.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	103	270	6e-31	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	3.60e-102	100	328	1	233	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
PRK11498	bcsA	4.24e-72	100	500	260	665	cellulose synthase catalytic subunit; Provisional
COG1215	BcsA	2.59e-49	35	501	1	424	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06437	CESA_CaSu_A2	6.55e-32	100	324	1	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
cd06423	CESA_like	1.17e-31	104	281	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPJ85522.1	1.96e-183	4	625	2	642
CED93608.1	1.24e-178	15	625	11	624
QPJ85521.1	3.07e-177	4	626	6	647
QJA08755.1	4.71e-154	15	432	11	431
CDM68038.1	1.79e-153	21	616	24	628

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	1.41e-55	3	422	177	598	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	8.64e-51	99	446	127	497	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.71e-50	99	446	139	509	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.72e-50	99	446	140	510	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
6YV7_B	4.06e-09	100	296	42	237	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9WX61	2.49e-63	21	540	69	588	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
Q9RBJ2	8.03e-59	21	526	66	579	Putative cellulose synthase 2 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-A PE=3 SV=1
Q9WX75	8.03e-59	21	526	66	579	Putative cellulose synthase 3 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-B PE=3 SV=1
Q8Z291	1.16e-58	3	500	177	678	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
P19449	1.52e-58	4	605	62	674	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999993	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
4	20
33	55
59	81
353	375
385	407
458	480
490	512