CAZyme Information: MGYG000000287_03989

Basic Information

• Species: Robinsoniella sp900539655
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900539655
• CAZyme ID: MGYG000000287_03989
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1454	MGYG000000287_75|CGC1	156559.43	4.5212

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000287	7249439	MAG	Sweden	Europe

• Gene Location: Start: 18708; End: 23072 Strand: -

Full Sequence      

MKRKAKAMPKKLMAYMITTALIAGTISYAVPIDTKATENQESDGQSVTFTPAPAGHVYAG
MPLFDGVPAHYEQYLDAVIDYIGLEGAARFAFDTRGDYVLTQGENAGRTIPGSLTFTDCV
QGVSTDFPAIIGLGQSWNKDLVASVGNVLGNERVNKVDYSSLSDINVMACTATSDLRINP
LSGRFDEGFAEDPYLAASMVNEMATGVSGIAQAENPEGFWQKAVVTTKHFTTYNAQTFRS
VASNNASARTLLEYQPQSTFKGIESGAIGGFMSSYGRTNGIPNIISPLINYAKSLSPYGL
FSVTDAGSVSNQSGYGNGFDSSYVPLIDDSAYNGAGYSSIGALMAVANSAGASTTRANDA
SFQTLIDQVEAGTYGVTQSDVENVARDQIGQLVRCGVLNEDMNDYPFYSQSAGVGAADDY
NNTYNQGVALEAAQESIVLLKNDNDVLPLDKEDSVYVSGPMSVARFKTTYAVGKSPEIDN
ALYSTAAGIRKIGGEDKVKYSTDAEVVRIKTADGKYIALSDDGKSLVTVSEQEKAAKFEK
YSWGQDGYSYKCLNNDKWLKGVTTGGGWGGGGTFTGVEASGTESLEQIVNDLEATYVTTS
MPYRFRVEENSDQTISYIMESYSESFVGTTPVVGYYTNGRYLSVDGENVAFSDKLQDQTT
AESLRTESARFTEEIVKEAGAETKESASDYAVVVVGAPARHSSGEGCDRSDMYLGEDQYK
QVENVAAAYPGKTIVVVQTNYPEIIEEIKQNNNVAAILVQPYAGQYGGYAMGQVIYGDVA
PTGRLTSTWYSSNEVLPEITPYSIPEGMDLTLDQLDPRFTTDMTNSDPVQTGLTYMYSDD
SNITYEFGAGLTYTTFAYSNLQLPESVHAEDGSFQISVDVTNTGDTASSEVVQAYISNNN
SAYGSYAPKIKLVSFEKAEIEPGQTKTVVLSVDPKDFELWDTNSHSYIIETGNYDIMVGS
SSRNILQQGMVSVTGGAIGELDAGSPVNVFDCSYAGSGVVYREVSKEHTAESLANASRDN
EENAQSRVASGYYAVMSEREGAWTAMKNVNLDEVTKICANVATRNEHAAIDVRSDSPDGE
LIASINFDITPVNSYTAPETGENPEAAVDLPVNELAYEDVTIELESPLLGVHDVYLVFAN
ADTRINTIQFVKEQTEQVSVDKSVLTAVIAKVNAVNDEYYTAESYARVSEAVKKAETVIS
REDASQEEVDAAVMEIVNALSGLTVKPAEEEKIQYADIRALNQAAEKARAVDRSKYTAES
LARLDSILQAAQELIRVAPEKQLQSVVDVVAKSVNDAVGSLEIREISTLPKKGLKVTAGK
LKYKITASSSSKRTAAVTAPAKMSYTSISIPSTVKISGYTYKVTAIADKAFKNSKKLKTL
KIGSNVTSVGKQAFYNCKKLKNITVTAKGITKVGTNALKGIDKKAVLKVPSSKLKKYKAL
FKNKGQKSTVTIKK

Enzyme Prediction     

No EC number prediction in MGYG000000287_03989.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	115	310	1.4e-23	0.8425925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.30e-32	118	968	111	760	beta-glucosidase BglX.
pfam01915	Glyco_hydro_3_C	2.69e-26	650	807	55	211	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam14310	Fn3-like	4.51e-20	890	962	1	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.
PLN03080	PLN03080	3.11e-18	688	959	488	769	Probable beta-xylosidase; Provisional
cd04084	CBM6_xylanase-like	1.12e-13	1029	1150	20	123	Carbohydrate Binding Module 6 (CBM6); many are appended to glycoside hydrolase (GH) family 11 and GH43 xylanase domains. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family domains, including GH3, GH11, and GH43 domains. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB6s belonging to this family are Microbispora bispora GghA, a 1,4-beta-D-glucan glucohydrolase (GH3); Clostridium thermocellum xylanase U (GH11), and Penicillium purpurogenum ABF3, a bifunctional alpha-L-arabinofuranosidase/xylobiohydrolase (GH43). GH3 comprises enzymes with activities including beta-glucosidase (hydrolyzes beta-galactosidase) and beta-xylosidase (hydrolyzes 1,4-beta-D-xylosidase). GH11 family comprises enzymes with xylanase (endo-1,4-beta-xylanase) activity which catalyze the hydrolysis of beta-1,4 bonds of xylan, the major component of hemicelluloses, to generate xylooligosaccharides and xylose. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKS56187.1	7.56e-283	16	1150	16	1144
AYA77556.1	3.81e-277	10	1150	12	1145
QMV43973.1	2.13e-256	55	1156	21	1123
AYQ75660.1	5.19e-231	19	1158	14	1140
QOS79412.1	1.10e-199	38	1152	13	1125

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.15e-27	111	966	47	829	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
7MS2_A	3.92e-27	661	973	379	668	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
6JBS_A	1.12e-24	703	965	527	795	Bifunctionalxylosidase/glucosidase LXYL [Lentinula edodes],6JBS_B Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_C Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_D Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes]
4I3G_A	1.16e-24	124	973	111	828	CrystalStructure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
3ABZ_A	2.06e-24	111	966	47	829	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27034	2.12e-27	100	965	39	802	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
D5EY15	2.34e-27	122	962	80	849	Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyl3A PE=1 SV=1
P33363	1.27e-26	118	965	111	757	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
P14002	2.15e-26	661	973	379	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
A2QPK4	4.50e-25	703	973	486	750	Probable beta-glucosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglD PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001032	0.998015	0.000321	0.000225	0.000194	0.000173

TMHMM  Annotations     

start	end
12	31