CAZyme Information: MGYG000000289_00309

Basic Information

• Species: Prevotella buccae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella buccae
• CAZyme ID: MGYG000000289_00309
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
281	MGYG000000289_2|CGC2	33095.87	9.1081

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000289	3001000	MAG	Sweden	Europe

• Gene Location: Start: 150185; End: 151030 Strand: -

Full Sequence      

MLLSIIVTSQDRPKELKRYFETINKQKNINFSNLQIIFVDQGDNKSIYDNLSQSIIRKYV
KYYKCGLSEARNQGLKFVIGDIVAFGDDDSWYDDDTLSKVFDLFEKRNIDGVGTAIKNES
DVPYNKYPQEIKKLTYLNHYGLSSASIFLKYDSSVSFDVNIGVGSKFNLLSGEETDYLWT
YMERHPNFVIEFHPEITVRHPVLQKQNFNNYLDKCYYYARGFGYIMKKHSLPATFIIQNF
LRPFMGIFVYLLVNNFRCRKSYYILKGRMEGYLYNIKNLDK

Enzyme Prediction     

No EC number prediction in MGYG000000289_00309.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	131	1.3e-17	0.7647058823529411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	1.23e-07	4	85	1	84	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	6.15e-06	5	85	1	83	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
PRK10073	PRK10073	2.12e-05	2	85	7	91	putative glycosyl transferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXV50485.1	2.02e-118	1	281	1	279
QUB94427.1	2.02e-118	1	281	1	279
QUB92045.1	1.65e-117	1	281	1	279
ANE50012.1	4.76e-36	4	272	15	281
BAD77598.1	5.28e-33	1	274	1	278

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
231	253