CAZyme Information: MGYG000000289_00626

Basic Information

• Species: Prevotella buccae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella buccae
• CAZyme ID: MGYG000000289_00626
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
635	MGYG000000289_5|CGC3	71327.93	6.7528

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000289	3001000	MAG	Sweden	Europe

• Gene Location: Start: 90283; End: 92190 Strand: -

Full Sequence      

MKKTFLIVCACLLTMLGGRAESKSAGGGFTRDDYAGIIDISLTPTGQEKQIGCFTDQGAW
MGFTLPGRDKPAGGFCGPFSINGRWWFAKSAVSLMAGGKPLPHERADYVPGKIGLCLKAD
DGCVEEQLLFVDSRTALLHVTNTGRRQLTFSALEPHRALTVRKEGNHLVLGGLPGETLML
TFPPSAELRVAGNNYTATLPPGLGEADIVVSMLLPGDRQEAQRCYANSLLGNYRACENDN
LARWNGYLNKVLRPDMPTDYNRVAVKAVTTLVSNWRCLRGGLLHDGIVPSHAVGYFVGCW
AWDCWRFSAAMASFFPELAKDNIRVMFDYQQSDGMVIDCIYVDPRENNARDSKPPLACWA
VDRVFEATGDTAFVREMYPKLLHYYRWWYRHRDHNANGICEFGSADGTLEAAAWESGMDN
AIRFDGAKMLHNGGAAWSIDQESVDLNAYLAYEYTLLGKFAALLGMAFDEPDLRGKVADY
FFDDAEGYFFDRRLADGRFVREPGCEGYLPFWTRIATRAQWLKARRLLEDPRKFATYIPF
PTIAADNPKYDANGYWRGPIWLDQTYYAIEAFRNYGEPRKADGYTRRVFDRLQGLSGDAP
IYENYDTFTGRPLQASHFSWSAAHLLLLYERYGKK

Enzyme Prediction     

No EC number prediction in MGYG000000289_00626.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	220	632	3.9e-98	0.5105263157894737

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	4.52e-127	2	635	3	786	alpha-glucosidase; Provisional
COG3408	GDB1	4.17e-21	285	629	270	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	7.25e-09	352	633	178	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam03200	Glyco_hydro_63	5.90e-08	371	630	185	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
PLN02567	PLN02567	0.003	296	498	150	389	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT67704.1	4.21e-282	30	634	25	626
ADY37311.1	3.58e-257	3	634	7	638
QUT33387.1	2.10e-247	34	634	35	642
QJR62245.1	4.52e-247	31	634	34	644
QJR74523.1	4.52e-247	31	634	34	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	6.73e-76	32	635	3	759	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	3.47e-75	32	635	3	759	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	4.82e-75	32	635	3	759	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	6.64e-73	32	635	4	760	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
6XUX_A	1.39e-39	32	404	329	768	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	1.48e-75	3	635	4	782	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	1.34e-19	292	626	90	482	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	3.17e-19	292	626	90	482	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001420	0.603932	0.393851	0.000350	0.000232	0.000201

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000289_00626.