CAZyme Information: MGYG000000289_01254

Basic Information

• Species: Prevotella buccae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella buccae
• CAZyme ID: MGYG000000289_01254
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
816		92627.77	7.0287

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000289	3001000	MAG	Sweden	Europe

• Gene Location: Start: 5495; End: 7945 Strand: -

Full Sequence      

MKKSLSVFLLLLCLVSATARERRLFDSDWLFVLGNDAKMASPDYDDTSWRRLNLPHDWAI
EGDFSDANPSGAGGGALPGGIGWYRKHFNVENSHPDMRYFLEFDGVYMNSTVYVNGHEVG
HRPYGYSSFEYDVTPYINKGGENVVAVKVDNSDQPNSRWYSGCGIYRHTWFTTTHRMHIA
HWGTHVVTTPKGELNVAIQMADEAIKGEKPAYRNTVMDAAGKVVASMMTGSPQQLLKVKR
PQLWSVERPYVYTVKSEVILNNQVVDEVLTITGFRDFKFDSKTGFWLNGKNLKINGVCDH
HDLGCLGAALNEDALHRQLVKLKDMGCNAIRCSHNPPAPELLNMCDTMGFIVMDESFDMW
RRKKTKNDYARFFDEWHERDLSDLVLRDRNHPSVMMWSIGNEVLEQWSGAGADELTLEQA
NLILNAGHDASTLAHGKEMTPNSILTKHLTDIIRRLDPTRPITAGCNEPDPNNHLFKSGA
LDIIGFNYHRQWVKDVPRNFPGKPFLMTESVSALQTRGYYKMPSDSVFVAPERWDKMFTD
PSMMCSAYDNTHAPWSSTHEATWDIVKHTPYCAGQFIWTGWDYIGEPTPYGFPARSSYFG
IIDLAGFPKDIYYMYQSEWSSKPVLHLFPHWNWLPGQKIDLWCYYNNADEVELFVNGKSQ
GIRRKKDSHQYHVMWRVTFEPGEVKVIARKNGKDVRSQVIKTASAPNHIRLSIDYAGQRG
DVGAANATMSNQESLTFINAEIVDKDGNLCPWAENQLFFETDNGAIGGVDNGSQFSTERF
KDNKRKAFFGKCMVVVKGKGKLTAKAYDLKTAKIDF

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	18	637	4.3e-124	0.598404255319149

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	5.25e-62	25	407	30	411	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	6.06e-45	20	463	10	446	beta-D-glucuronidase; Provisional
PRK10340	ebgA	3.81e-32	84	402	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	4.35e-28	285	592	8	274	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam16355	DUF4982	2.16e-26	636	695	1	59	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT65145.1	0.0	1	814	1	831
BCS86030.1	0.0	3	814	4	815
VEH16023.1	0.0	3	811	4	814
QUT61321.1	0.0	25	812	26	825
QQA29801.1	0.0	25	812	33	832

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YPJ_A	3.01e-198	21	806	7	793	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
7CWD_A	1.76e-195	25	796	6	774	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
5T98_A	1.33e-184	25	813	30	815	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
3GM8_A	3.53e-162	25	814	9	794	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
4CU6_A	4.02e-157	25	814	18	840	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU7_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU8_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	0.0	20	812	42	842	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	7.48e-150	3	791	26	788	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	8.08e-69	7	760	30	767	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
T2KN75	2.84e-57	15	777	21	752	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
P77989	5.54e-54	25	760	8	686	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000320	0.998792	0.000291	0.000186	0.000188	0.000176

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000289_01254.