CAZyme Information: MGYG000000289_01350

Basic Information

• Species: Prevotella buccae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella buccae
• CAZyme ID: MGYG000000289_01350
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383		43113.36	7.923

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000289	3001000	MAG	Sweden	Europe

• Gene Location: Start: 20333; End: 21484 Strand: -

Full Sequence      

MLIACQSNQQPVVTPWGTTLTEDADTAEATGNFSLPDIIKNGELIMLTISGPETYYDYHD
HGMGLQYLLCEKFAQKLGVSLRVEVCKDTAEMVKRLAKGDGDVIAFPLPKTTKGDLQFCG
AGIDSLQVQWAVKKDNKELADTLNNWFRPDMIAEVKSEESFMLSSRSVIRHVYSPMLNRS
KGVISEYDRYFQMYAPMARMDWRMMAAQCYQESCFDPKARSWAGALGLMQIMPGTAAHLG
LPISQIHNPEDNIAASARYMAELGGLFNDIADPGQRCWFVLASYNGGYHHIRDAMALARR
EGRNAHNWGEVAEFVLKLREARFYNAPIVKYGYMRGNETVDYVDRIRNRWAEYRGVAKGG
GIGLSSFHGMTPQRAKLKNKFKL

Enzyme Prediction     

No EC number prediction in MGYG000000289_01350.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	200	349	9e-27	0.7851851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	6.35e-72	191	354	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	8.19e-48	1	348	17	445	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	1.57e-42	35	347	16	425	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
cd13401	Slt70-like	2.33e-23	211	292	30	112	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	3.84e-22	191	306	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO48082.1	5.30e-186	2	383	15	391
VEH15587.1	4.02e-179	1	383	44	433
QNT65891.1	5.72e-178	1	383	15	419
QUB48180.1	3.05e-171	4	383	18	392
EFC70077.2	4.33e-171	1	383	14	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	1.19e-23	184	347	256	415	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OYV_A	1.27e-23	184	347	263	422	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OWD_A	1.27e-23	184	347	263	422	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA4_B	1.44e-23	184	347	249	408	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	1.44e-23	184	347	249	408	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8ZWR8	4.41e-32	34	346	33	441	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
A0KJ50	6.02e-30	30	347	35	447	Membrane-bound lytic murein transglycosylase F OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=mltF PE=3 SV=1
A4SNZ5	1.23e-27	30	347	35	447	Membrane-bound lytic murein transglycosylase F OS=Aeromonas salmonicida (strain A449) OX=382245 GN=mltF PE=3 SV=1
B1KLC4	2.72e-27	87	347	173	435	Membrane-bound lytic murein transglycosylase F OS=Shewanella woodyi (strain ATCC 51908 / MS32) OX=392500 GN=mltF PE=3 SV=1
A8FY01	3.72e-27	87	347	173	435	Membrane-bound lytic murein transglycosylase F OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999917	0.000107	0.000022	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000289_01350.