CAZyme Information: MGYG000000289_02273

Basic Information

• Species: Prevotella buccae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella buccae
• CAZyme ID: MGYG000000289_02273
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	MGYG000000289_57|CGC1	36638.5	7.3581

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000289	3001000	MAG	Sweden	Europe

• Gene Location: Start: 5395; End: 6372 Strand: -

Full Sequence      

MKNLLLTLLLLAATGIHAANKYDNPDTLFVSRDGTCEFRNIDDAIEVCRAFMDYHKVIFV
KKGIYKEKLIIPSWLTHIEICGEDRDQTIITYDDHANIKRLDNGRPMGTFRTYTLKIEGS
DITLRNITIENNAARLGQAVALHTEGDRIAFVNCRFLGNQDTVYTGVGGTRLYFLGCYIE
GTTDFIFGPSTAWFEDCTIFSKADSYITAASTPAAQAFGYVFNHCRLTAASEVDKVYLGR
PWRPYAYTLFMDCDLGQHIRPEGWHNWGKTSNEQTARYMEYDNRGPGASTAGRAPWSRQL
TKKEAAKITLATVFGSDRSWIPASR

Enzyme Prediction     

No EC number prediction in MGYG000000289_02273.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	29	313	2.3e-99	0.9791666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	4.43e-75	28	321	7	305	pectinesterase
pfam01095	Pectinesterase	3.30e-74	30	317	4	298	Pectinesterase.
PLN02682	PLN02682	7.35e-69	17	322	60	368	pectinesterase family protein
PLN02432	PLN02432	5.73e-63	30	321	15	292	putative pectinesterase
COG4677	PemB	2.77e-60	57	314	114	402	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB28242.1	9.82e-179	2	323	3	324
BCS84477.1	2.13e-178	13	323	14	324
QVJ81978.1	5.20e-176	1	322	1	322
ADE82952.1	5.20e-176	1	322	1	322
QJR97878.1	2.88e-165	19	322	13	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	3.08e-42	30	324	11	311	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	3.42e-38	28	324	11	298	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	6.71e-38	28	324	11	298	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1XG2_A	1.42e-37	30	296	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	7.39e-30	31	322	12	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.30e-59	30	321	9	305	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P41510	1.29e-50	27	313	272	563	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q5MFV6	7.11e-50	27	313	276	567	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
Q8VYZ3	1.22e-48	18	321	75	381	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q42608	2.08e-48	27	313	259	550	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000219	0.999177	0.000149	0.000152	0.000141	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000289_02273.